KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1398Help
Entry
Cp106_1398        CDS       T02052                                 

Gene name
glk
Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00010  Glycolysis / Gluconeogenesis
cod00052  Galactose metabolism
cod00500  Starch and sucrose metabolism
cod00520  Amino sugar and nucleotide sugar metabolism
cod00521  Streptomycin biosynthesis
cod01100  Metabolic pathways
cod01110  Biosynthesis of secondary metabolites
cod01120  Microbial metabolism in diverse environments
cod01130  Biosynthesis of antibiotics
cod01200  Carbon metabolism
Module
cod_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp106_1398 (glk)
   00052 Galactose metabolism
    Cp106_1398 (glk)
   00500 Starch and sucrose metabolism
    Cp106_1398 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp106_1398 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp106_1398 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp106_1398 (glk)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp106_1398 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR FGGY_N DEDD_Tnp_IS110 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AER69458
Position
complement(1526032..1526985)
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIGLVDNLKQKH
EVSAVGLAVAGFLDPDCEVVRFAPHLPWRDRHVRAELSDALGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRTCSCGKRGCL
ERYCSGTALETTAREMIAAGKATESVLIDYLADGSLSGKRIMAAASDGDQLACAVVEDFA
QWMGRALSVVADVLDPGLIVIGGGVSTASALYIDTAVETMAASMVGAGYRPLPTVSCAKL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggcactaacatgcgg
gcggcggcggtgacttcggatggtcagattattgactctatgtcggttcctacgccatca
actcctgaattacttgaatcgggcatcatcgggttggtggataacctgaagcaaaaacac
gaggtttccgcagtaggcctcgccgtagctggcttcttggatcctgattgtgaggtcgtt
cgttttgctccgcaccttccgtggagagatcggcatgtccgtgcagaactttcagatgct
ttagggctacctgtccggcttgagcacgatgcaaattctgctgcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctttttgccgtgggaacaggaattggt
gcaacccttatgcatcaaggagaaatttaccgtggggcttttggcacagcgccggaattc
gggcacctcactgtggtaccaggggggcgaacatgttcctgcggtaaacgaggctgcctt
gaacgctactgttcgggaactgccctggaaactactgcccgcgagatgatcgcggcgggc
aaagcaacagagtccgtgcttatcgactatctagctgatggttccctgagcggtaagcgc
attatggccgcagctagcgacggtgatcagctggcctgcgctgtagttgaagattttgcg
caatggatggggcgagccctatccgtggttgccgatgtccttgatcccggtcttattgtg
attggtgggggcgtatccactgcaagcgcgctttatattgatactgctgtggagacaatg
gctgcatcgatggtgggggcaggataccgcccccttcccacagtttcgtgtgcgaagcta
ggcggagatgcgggtatgatcggggtatctgatttggctcgccaattggtttga

DBGET integrated database retrieval system