KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1688Help
Entry
Cp106_1688        CDS       T02052                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cod00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cod00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1848043..1848516)
Genome map
AA seq 157 aa AA seqDB search
MTNFFDIPVTLNDATETTMNDWAGHCLMIVNTASRCGLTPQYEALEELYRDYAPRGFFVI
AMPCNQFAEEEPGSNKQIAEFCKREYGVTFPILEKADVNGENTHPLYQFLKGDGPDIEWN
FEKFVVSPEGKVVGRFAPNMEPDDLKIIECLEDNVVL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttctttgatattccggtgacgcttaatgacgccaccgagacaaccatgaat
gattgggcagggcattgcctcatgatcgtgaacaccgcatctcggtgtggtctgactcct
caatatgaagccctggaggagttgtatcgggattatgcgccacgcggattttttgtgatt
gcgatgccttgcaaccagtttgctgaggaagaacctggatccaataaacagatagcagag
ttctgcaagcgggaatatggcgtgactttcccgattcttgaaaaagcagacgttaacggg
gagaacacacatccgctgtaccaattcttaaaaggagatggccccgatatcgagtggaac
tttgaaaagtttgtggtctcgcctgaaggaaaggtcgtagggcggttcgctccgaatatg
gagccggatgatttgaagatcatcgagtgcttggaagacaacgtggtgctttag

DBGET integrated database retrieval system