KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1747Help
Entry
Cp106_1747        CDS       T02052                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cp106_1747 (folK)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cp106_1747 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1909273..1909686)
Genome map
AA seq 137 aa AA seqDB search
MKAVLSIGSNMDDRYALLRSAYEEFLPDLVAASSIYATPPWGVEDQDEFLNAVLIVDVDE
TPMELLKRGQALEQAAERKRIRRWGPRTLDVDIVCIEGVTSDDPVLTLPHPYAHERNFVL
VPWLEADPEATDAHYRS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagttttatccatcgggtctaatatggatgaccgctatgctttgctgaggtca
gcgtatgaggaattcctgcctgatctggttgccgcatccagcatctatgccactccaccg
tggggcgtagaagaccaggatgagttccttaacgcggtgctcatcgtagacgtggatgag
accccgatggagctgcttaaacgcggtcaagccctagaacaggccgcggagcgcaagcgg
attcgacgctgggggccccggacactcgacgtagatattgtgtgcatcgagggcgttaca
tcggatgatcccgtgctcacattgccgcacccttatgcccacgagcgtaattttgtgctg
gtgccgtggcttgaggcggaccctgaggcgacggacgcccattatcggagctga

DBGET integrated database retrieval system