KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1846Help
Entry
Cp106_1846        CDS       T02052                                 

Gene name
adhA
Definition
alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cp106_1846 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp106_1846 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp106_1846 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cp106_1846 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cp106_1846 (adhA)
   00626 Naphthalene degradation
    Cp106_1846 (adhA)
Enzymes [BR:cod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cp106_1846 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2016590..2017627)
Genome map
AA seq 345 aa AA seqDB search
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRAGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGKVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggcatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
cccgagccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcgccggacgtgaaaccctttgcaatgacgccgaatatggc
ggatatacggtcgacggttcttttggcgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccggggcagtacatggtgatttccggc
atcggtggcctggggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcggatgagaaactcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggctaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcaaggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system