KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1891Help
Entry
Cp106_1891        CDS       T02052                                 

Gene name
nagA
Definition
(GenBank) Beta-N-acetylglucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
cod00520  Amino sugar and nucleotide sugar metabolism
cod01100  Metabolic pathways
cod01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cp106_1891 (nagA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Cp106_1891 (nagA)
Enzymes [BR:cod01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cp106_1891 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 HOIP-UBA
Motif
Other DBs
NCBI-ProteinID: AER69927
Position
complement(2070517..2071632)
Genome map
AA seq 371 aa AA seqDB search
MHMKRLLAAALLGVLAACSDAGTNTDPTSTEATTALTTQETSAPASAKPQPEDVRAKAAS
LMMVGVSNYDDALAALNQGAGGIFIGSGTDPNLLTAPDRNIQALRKAVGRDLSVSTDFEG
GRVLRHQGILGTFPSPQVMAQTMNPEQVRGMAKAMGDSLLAHGVTVNFAPVADIDAGLDV
VGDRAFSADPNIDAEYATAFAQGMLDAGVRPVFKHFPGHGRASGDSHTGQVFTPSLGDLE
NIDLVPYGRINIPGAGVMLGHMVVPDLGAPQNGLPSTLNPAAYQLLRTGAYRDGRPFAGV
VYTDDLAMGAITGVMPIPQAVVASLQAGADQALWVTTAGLKEAIDATVAAVETGTYPRAQ
FEESVRRVGVV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgaaacgacttctcgccgccgccctcctcggtgtgctcgctgcatgtagcgac
gccggaaccaatacggatcccaccagcactgaggccaccactgcgttaacaacgcaggaa
accagcgcgcctgcaagcgcaaaaccacagcctgaggacgtccgcgctaaagccgcgagc
ctgatgatggtgggagtaagcaattacgacgacgcccttgctgccctaaaccaaggcgct
gggggtatcttcatagggtccggcaccgatcccaatcttctcaccgctccggatagaaac
attcaggcgctgcgtaaggccgtggggcgagacttgtctgtctcgaccgattttgaggga
gggcgtgttctccggcatcagggaattctgggcaccttcccctcgccccaagtgatggca
caaaccatgaaccccgagcaggttcgagggatggctaaagcgatgggcgactcattgctg
gctcatggagtgaccgtgaattttgctccggtcgcggatatagacgctggattagacgtt
gtgggcgatcgtgcctttagcgcagacccaaatattgatgcggaatacgccacagctttt
gcccaaggaatgcttgatgctggagtccggccagtgtttaagcacttcccggggcatggc
cgcgccagtggcgattcacacacaggacaggtattcacgccctctttaggtgacctggaa
aacattgacctagttccttatggccggattaatatccccggtgccggcgtgatgctcggg
catatggtggttcctgatctaggcgctccccagaacggacttccatccactctcaatccg
gccgcataccagttactacgcactggggcttatcgtgatgggcgtcctttcgccggcgtg
gtctacacggatgatcttgctatgggagcaatcaccggggttatgcctatccctcaagcc
gtagtggcctcgctgcaagctggcgcagatcaggctttgtgggtgaccactgcggggctt
aaagaagctatcgacgctaccgtggctgccgtggaaaccggcacgtatcccagggctcaa
tttgaagagtcggtacgccgggttggtgttgtttaa

DBGET integrated database retrieval system