KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_1947Help
Entry
Cp106_1947        CDS       T02052                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cp106_1947 (deoA)
Enzymes [BR:cod01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cp106_1947 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2145153..2146508
Genome map
AA seq 451 aa AA seqDB search
MSTLAELPYSTSPALTAPMEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIV
GDDQMAALNMAIFLNGMDREEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITL
PLAPLVASYGVAVPQLSGRGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAA
GAGLAPADKKIYALRDITATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQ
ARELARTMVDLGRDAGTNMVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTC
ALATEMLELAGVHDPDVHEALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEATADRDG
YLTEMDALALGVASWRLGAGRARKEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDR
FSRALESLEPGVNIGDEPPAPRPSVILDRIS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgagtactctggccgagttgccatatagcacttccccagccttaacagctccaatggaa
ggtgataccgtggccgagaaattcgacgccgtagacgtcatccgcacaaagcgggacaac
gggaagctaagcaagggacaaatcgactggatcatcgacgcctacactcgcggcattgtt
ggcgacgatcaaatggctgccctcaacatggcaatattcctcaacggcatggacagagaa
gaaatcgtccagtggacccaggccatgatcgactccggcgagaccatgagctttgccagc
ctctcccggccaacaacagacaagcactccaccggcggggtcggcgataaaatcacgctt
ccacttgcgccactcgttgccagttacggcgttgccgtgccacaactctctggtagagga
ctaggacacacaggcggaaccctagacaaattagaggccatccccgggtgggaagctgac
atagataatgcccgaatgatgaagatcctcgaagaccccggctgcgtggtatgcgccgcg
ggagcaggcctcgcacccgccgacaagaagatctatgcgctgcgtgacatcactgccacc
gtcgactgcatcccgctgatcgccagctccatcatgagtaaaaaaatcgccgagggaacc
gcaaacctagtcctcgacgtcaaggtgggttccggggcctttatgaaggagcttgaccag
gcccgcgagctcgcccgcaccatggttgacctaggccgcgacgccggaaccaatatggtc
gcgcttctcaccgacatgtccgtccccctggggcgcaccatcggcaatgccctagaagtt
cgcgagtctgtagaagtcctcgcaggcggtggcccttccgacgtcatagagctcacctgc
gcccttgcgacggagatgcttgagctcgccggcgtccatgaccccgatgtccacgaagcg
cttgccgacggccgcgcgatggactcttggaagaagatgatccgcgcgcagggcggcgac
cccgacgcagcgctccccaccgcacggcacacccatgaggccaccgccgatcgcgacggc
tatctcacagagatggacgccctcgcactgggagtagccagctggcgactcggcgcagga
cgcgcacgcaaggaagatccagtccaactcggcgcaggcatcgagatccatgcagagctc
ggcgagaaggtttcaaagggccagaagcttttcaccctccacaccgacgatgaggaccgt
ttcagccgagccctagaatccctcgaacccggcgtaaatatcggcgatgagcccccggca
cctcgcccctcggtcatccttgatcgcatcagctaa

DBGET integrated database retrieval system