KEGG   Corynebacterium pseudotuberculosis 1/06-A: Cp106_2019Help
Entry
Cp106_2019        CDS       T02052                                 

Gene name
nanK
Definition
N-acetylglucosamine kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cod  Corynebacterium pseudotuberculosis 1/06-A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cod00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp106_2019 (nanK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp106_2019 (nanK)
   00052 Galactose metabolism
    Cp106_2019 (nanK)
   00500 Starch and sucrose metabolism
    Cp106_2019 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp106_2019 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp106_2019 (nanK)
   00524 Butirosin and neomycin biosynthesis
    Cp106_2019 (nanK)
Enzymes [BR:cod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp106_2019 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2225804..2226739)
Genome map
AA seq 311 aa AA seqDB search
MISAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLAASYNAHAENPAVDLHEIMTRYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQDQINKVSI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgcaggcaataaagtgcaaacccccgtgcgcatcggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacccccgcgagcaacgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctactgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatctgct
gccctcttagagtccttcgcctctggtcctggactcgctgcctcctataacgcgcatgcg
gagaacccagccgtggatctccacgagattatgactcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcctgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtgggagccgcatatctgggg
aagacccaagaccaaatcaacaaagtatctatttaa

DBGET integrated database retrieval system