KEGG   Corynebacterium pseudotuberculosis 258: Cp258_0493Help
Entry
Cp258_0493        CDS       T02118                                 

Gene name
rbsK
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cp258_0493 (rbsK)
Enzymes [BR:coe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cp258_0493 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(500033..500935)
Genome map
AA seq 300 aa AA seqDB search
MLKTVAVVGSINADLSVRVHRPPTPGETVLGMDSSISPGGKGANQAVAAALQGAKVVFIG
AVGKDSYAEPAMELLRASSVSLEHVSAVDGPTGSAVITVSDDGENSIIVIPGANAAVDAA
YVAKNAEAIAGADIVLLQGEIPADGFLEAIKAATGRIVVNLAPVISVDREALLKADPLMA
NEHEANLILEQLGSSISSDDPHELAQELLAQGFASVVLTLGSKGALVADPQASVIVPSPK
VTAVDTTGAGDAFAGAFVAQLLSGASSVEAAQHAVRVAAYAVQYRGTQVSYPNAGAELPR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagactgttgccgtcgtaggctccatcaatgcagatttgagcgtgcgtgttcac
cggcctcctacgccgggagagaccgtcctcggcatggatagttccatttctcccggtgga
aaaggcgcgaatcaggcagtagcagcagcactccaaggtgcaaaagttgtcttcatcggc
gctgtaggtaaagattcctacgccgaacccgctatggagttgctgcgcgcctccagcgta
tctctagaacatgtctcggctgtcgacggccccacgggcagcgcagtaatcacagtttct
gatgacggagagaactccatcatcgtgatccctggcgcaaatgctgctgtcgacgccgct
tatgtggccaaaaatgcagaagctatcgcaggtgcggacattgtacttcttcagggagag
attcctgccgatggattcctcgaagcgataaaagcagcaactggtcgcattgtggtcaac
cttgctcccgttatatccgtggatcgtgaagctttgctcaaagcagacccactcatggct
aacgagcatgaagccaacctcattctggagcaactgggcagcagcatcagcagcgatgac
ccgcacgagctcgctcaagaattgttagcccagggttttgcctcggttgttctcactcta
ggtagtaaaggcgcgcttgtggcagatcctcaggccagcgtcatagttccgtcaccaaag
gtaaccgcagtggacacaactggagctggggatgccttcgctggcgcctttgtggcccaa
ttgctcagcggggcgtcttctgtagaagctgcacagcacgccgtccgggtcgccgcctat
gccgtgcagtatcgaggcacccaggtctcctaccctaacgcgggcgccgaactcccgcgt
tag

DBGET integrated database retrieval system