KEGG   Corynebacterium pseudotuberculosis 258: Cp258_0616Help
Entry
Cp258_0616        CDS       T02118                                 

Gene name
echA6
Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
coe00071  Fatty acid degradation
coe00280  Valine, leucine and isoleucine degradation
coe00310  Lysine degradation
coe00360  Phenylalanine metabolism
coe00380  Tryptophan metabolism
coe00410  beta-Alanine metabolism
coe00627  Aminobenzoate degradation
coe00640  Propanoate metabolism
coe00650  Butanoate metabolism
coe00903  Limonene and pinene degradation
coe01100  Metabolic pathways
coe01110  Biosynthesis of secondary metabolites
coe01120  Microbial metabolism in diverse environments
coe01130  Biosynthesis of antibiotics
coe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cp258_0616 (echA6)
   00650 Butanoate metabolism
    Cp258_0616 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp258_0616 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cp258_0616 (echA6)
   00310 Lysine degradation
    Cp258_0616 (echA6)
   00360 Phenylalanine metabolism
    Cp258_0616 (echA6)
   00380 Tryptophan metabolism
    Cp258_0616 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cp258_0616 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cp258_0616 (echA6)
   00281 Geraniol degradation
    Cp258_0616 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cp258_0616 (echA6)
   00627 Aminobenzoate degradation
    Cp258_0616 (echA6)
   00930 Caprolactam degradation
    Cp258_0616 (echA6)
Enzymes [BR:coe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cp258_0616 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFK16256
Position
671083..671919
Genome map
AA seq 278 aa AA seqDB search
MLEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALASGFAAIQGDHAAAVAFAHEVAGLAPLSVRQLKSALNYGEAN
YSLDERSQSLFSQCWSSQDMREARQARLEKRVPQFKGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggcgctgggatgcagcttgct
ttggcgtgtgatctccgcgttgttggggagtctgcatggtttaaagtccccgctgtttct
ttgggctttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcgttgaccccggatgcggctctggctagt
ggttttgccgcaattcagggggaccatgccgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggcagctcaagtcggcgcttaattatggggaggctaat
tactcgttggatgagcgctcacaatccttattttcccagtgctggtctagtcaggatatg
agggaagcgcgacaggcgagactggagaaacgagttccccaatttaaggggcgataa

DBGET integrated database retrieval system