KEGG   Corynebacterium pseudotuberculosis 258: Cp258_0672Help
Entry
Cp258_0672        CDS       T02118                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cp258_0672 (galU)
   00052 Galactose metabolism
    Cp258_0672 (galU)
   00500 Starch and sucrose metabolism
    Cp258_0672 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp258_0672 (galU)
Enzymes [BR:coe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cp258_0672 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
728132..729088
Genome map
AA seq 318 aa AA seqDB search
MDTGCTLICMKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIEL
IAEEAAQLGATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPV
SVVQEKPLGLGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCA
FEVPEEEVYNYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFD
ALRRITPGAGGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPA
YGPHLKKVLRKILEEHGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggataccggatgtactcttatctgcatgaagcagcctcaagaagctcaagacagtacg
cgcgtcgcggtgaagactgtcatcgttcctgctgctggcatgggaacgagattccttcct
gccacaaaaacggttcctaaagaactattgccagtggtagataccccaggcattgaactg
attgcagaagaagcagctcagttgggggcaactcgactcgcagtaattacggctcctaat
aagcaggaagtcatggagcactttaagcgattcccagtgttggaagagaccctacaaagc
cggggcaaaaccgaacaatatgaaaaagttgttcatgcctctgagcttattgcgccagtt
tccgtagtgcaggaaaagccgctcggccttgggcatgctgttggcatggcggaatcagtc
cttgatcctgatgaggacgctgtagcagtcatgcttcccgatgatctagtgcttccgcgg
ggcgtcgtggagaagatggtcgaggtacgcgagcaactaggcggatctgtgttgtgcgcc
tttgaagtgccggaggaagaagtctataactacggtgtctttgagatcgatgagagtgca
tatgatggccctcatcacgtcaaaaaagtcaaaggaatggtagaaaaaccctctgtagaa
gaggctccttcaaattttgtggctaccggccgctatttgctcgaccgggctatttttgat
gcactccgtagaattaccccgggtgctggcggtgagctgcaactcacggatgccattgat
ttgcttatcgacgaaggccaccctgtgcatattcttgtgcatgacgggaagcgtcatgat
cttggcaaccccgggggatacataccggctgttgttgattttgggttgcgcgatccagcg
tatgggccgcacttaaagaaggtcctccgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system