KEGG   Corynebacterium pseudotuberculosis 258: Cp258_1372Help
Entry
Cp258_1372        CDS       T02118                                 

Gene name
trpC2
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
coe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
coe01100  Metabolic pathways
coe01110  Biosynthesis of secondary metabolites
coe01130  Biosynthesis of antibiotics
coe01230  Biosynthesis of amino acids
Module
coe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp258_1372 (trpC2)
Enzymes [BR:coe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cp258_1372 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFK16998
Position
complement(1508572..1509381)
Genome map
AA seq 269 aa AA seqDB search
MPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEIKRAA
PDKGVLAEINSPVGLAKELVAGGASLIACQTEWRRFHGSLSEMAEIRNVISVPIMCRDFI
VDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRAVAAG
AKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADAVVVG
EKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagtcttcgaagagattattgcgggcgtcattgaagatgtagctgcgcgagaa
tcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgagccgcctcgggat
gcaatagcggcgcttcttaatagtggttgtggtgtgatcgctgagattaaacgtgctgct
ccagataaaggcgttttagcagagatcaattctcctgttggcttagcaaaagaacttgtc
gccgggggcgctagtttgattgcgtgtcagacggaatggcgaaggttccacggttcatta
tctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgccgagactttatc
gtggatccctatcaaattcatgaggcacgctgttatggagcggacatggtgcccttgcgc
gtagctgctttagaccaagccaggatgattgcgcttatagatagaatcgagtccctgggg
atggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcggtggcagcgggt
gcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctcaaccgcctggcc
ttcgcagaaattgctcctggacttcctacagatgttattagagttgcattgtccggtgtg
cgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcggtggttgtggga
gaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttggtggcagcaggc
caacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system