KEGG   Corynebacterium pseudotuberculosis 258: Cp258_1461Help
Entry
Cp258_1461        CDS       T02118                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp258_1461 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp258_1461 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    Cp258_1461 (aceF)
Enzymes [BR:coe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cp258_1461 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1601794..1603431
Genome map
AA seq 545 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGTILEIL
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVM
PELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTV
DVGDVIVRIGEPGSEPETPKEEPKQEAPKAEPTKEAPKEEPAKEAAKPVDNQNVPYVTPL
VRKLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGPEPAQKEAPAAVKDPRANWSTKSV
DPAKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNKPAFIEK
YGVNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGLLTPVIH
KAQELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGI
LGTAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRLEKAKFQ
DDLNL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttcccccgttgccggcaccatcctagaaatcctc
ttcaacgaagacgacaccgttgacgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccaaagcaggaagcaccc
aaggcagaacccaccaaggaagcacctaagggctccgggtcctccaccgacgtggtcatg
cctgaactcggcgaatccgtcaccgagggaacaattacccaatggctcaagtctgtcggc
gacaccgtcgacgtcgacgaaccactactcgaggtttccaccgacaaggttgacaccgag
gttccttcccccgttgccggcaccatcctagaaatcctcttcaacgaagacgacaccgtt
gacgtcggcgacgtcatcgtccgcatcggcgaaccaggctccgaaccagaaacccccaaa
gaagagccaaagcaggaagcacccaaggcagaacccaccaaggaagcacctaaggaagaa
ccggctaaagaggctgcaaagccagtcgataaccaaaacgttccttatgtgaccccattg
gtacgcaagcttgctaataagtacggcgttgacctcaataaggtcgaaggcactggcgtt
ggcggccgtatccgtaagcaagacgttctcgccgcagccgggcaaggacctgagccggct
caaaaagaagcccctgctgctgttaaggatcctcgcgctaactggtccaccaagagcgtt
gatcctgcaaaggcagagcttattggtaccacccagaaggtcaaccgcatccgcgagatc
acggctaagaagatggtcgaggcgttgcagatttctgcacagctcacgcatcttcaagag
gtggatatgaccaacgttgccacgctgcgcaaggacaacaagccggcattcatcgaaaag
tatggcgttaacctgacctacctgccgttctttgttaaggccgtggttgaggctctagtc
ctgcacccgaacgtgaatgcgtcttacaacgctgccaccaaggagatcacttaccactcc
gacgtcaatattgcgattgcagtggataccgagcgcggtctgctcacccctgtgatccac
aaggcccaggagcttacgttgccggagatcgctcaggctattgttgatctggccgatcgc
gcccgtaacaataagctgaagccaaacgacctatccggcgcaaccttcactgtgaccaat
atcggttccgagggtgccttggcagataccccaatcttggttccaccgcaggttggtatc
ttgggcaccgctgcgatccagaagcgcccagtggtaatcactgagaatggctcagacgcc
atcgcaatccgtcaaatgtgctacatcccgttctcttatgatcaccagatcgtagacggc
gctgatgccggtcgcttcaccgcgacgatcaaggatcgcctggaaaaggctaagttccag
gacgacctcaacctctaa

DBGET integrated database retrieval system