KEGG   Corynebacterium pseudotuberculosis 258: Cp258_1481Help
Entry
Cp258_1481        CDS       T02118                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
coe00260  Glycine, serine and threonine metabolism
coe00750  Vitamin B6 metabolism
coe01100  Metabolic pathways
coe01110  Biosynthesis of secondary metabolites
coe01120  Microbial metabolism in diverse environments
coe01230  Biosynthesis of amino acids
Module
coe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp258_1481 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cp258_1481 (thrC)
Enzymes [BR:coe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cp258_1481 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFK17107
Position
complement(1633090..1634532)
Genome map
AA seq 480 aa AA seqDB search
MHYISTRDTSQTPVAFTDILLGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALA
AEVLKLFVDDIPAEDLEAITARAYTTPKFSDEEIVPVTKLEDGIYIGHLSEGPTAAFKDM
AMQLLGELFEYELLRRKETLNILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQ
AQMFGLDDPNIFNIALEGVFDDCQDVVKAVSSDAEFKADNHIGAVNSINWARLMAQVVYY
ISLWLKVTEKSNQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
EYRVRSAAETLETSSPSMDISRASNFERFIFDLLGRDPERCAELFGEQVKAGGFSLAEDD
SFEQAATHYGFASGSSTHADRIATIADCYTRRGLMLDPHTADGVKVAREWATQIESPIVC
LETALPVKFTDTIVEAVGRGPEIPERFTGILEAQRHVTDLPNDVVAVKNFILESIARDSA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgcactacatttcgacaagagacacttcccagacccctgtagcgtttactgacatcctc
ttgggaggtctcgctccagatggtggtttgtatcttcctgagtattacccgcgtctcgac
gctgccaccctagacacctggcgcggcattcttgcccagcaaggctatgcggcgctagca
gcagaagtgcttaagctctttgtcgacgacatcccggctgaggatctagaagctattact
gcgcgcgcttatacaacgcctaagttttccgatgaggaaatcgttcccgtgaccaagctt
gaggatggcatctatataggccacctctctgaggggcccactgccgcatttaaagatatg
gccatgcagctccttggcgagctctttgagtatgagttgctacggcgcaaggaaacttta
aacatcctgggtgctacctctggcgacacaggttcttctgcggaatacgctatgcgcgga
cgcgccggtatccgagtgttcatgcttacccctaaagatcgtatgacgccgtttcagcag
gcccagatgtttggtctagacgatccgaatatcttcaatattgccttagagggtgttttt
gatgactgccaagacgtggtcaaagcggtatcttcagacgcagaatttaaagcagacaac
catatcggcgcagtgaactcaattaactgggctcgcttgatggctcaagtggtgtactac
atttctttgtggctcaaagtaactgagaaaagcaatcaaaaagttagtttctgtgttccc
accggcaattttggtgatatctgcgcagggcatatagctaaacaaatgggattgcccatt
gacaggctcatcgttgctaccaatgaaaacgatgtcctggatgagtttttcagaactggt
gaatatcgtgtgcgttctgccgctgaaacccttgagacctcctcgccctcgatggatatt
tctcgggcatcaaactttgagcgttttatttttgacctattaggaagagaccccgagcgc
tgcgcagaactattcggggagcaagtaaaggccggcggtttctctctcgcagaggacgat
tcatttgaacaagctgccactcattatggttttgcatcgggcagctctactcacgcagac
cgcatagccaccattgccgattgttatacgcgtcggggcctgatgttggaccctcatacc
gctgatggtgtgaaagttgcgcgcgagtgggctactcagattgaaagccctattgtctgc
ttggaaaccgccctgccagttaaatttacggatactatcgttgaggccgtggggcgtggt
cctgagattccagagcgttttactgggattctcgaggcacaacgccatgtcaccgatctg
cctaatgacgttgttgcggtgaagaactttattctggaaagcattgctcgggactctgcg
taa

DBGET integrated database retrieval system