KEGG   Corynebacterium pseudotuberculosis 258: Cp258_1540Help
Entry
Cp258_1540        CDS       T02118                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:coe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646307..1648493
Genome map
AA seq 728 aa AA seqDB search
MGYTELLRELAAAHAVSCSFTGFGGEVTEVSDDTLVKTLRALGVRFGNEPEDSPNDHMPL
DAPMPSEEQIRAAIQKRRDEEDTRPLPRCVVATQGDPYVFNVHVHDGSPADITITLEDGS
VAADVTQIENWTPPRTVDGITWGEASFQIPQDLPLGWHTITLTSDTLTASCFLIITPQQL
STARTFVENPATGVMAQLYSVRSNDSWGMGDFHDLGELAKVVADKADADYILVNPMHAAE
PFPPVEDSPYLPTTRRFINPIYIRVEDIPEYLSLNDELQKEIEEISSEFKALNHSSDKIE
RNPIYDAKLQVLHAIFEAERDPAREQDFRDFVASEGDGLYDFALWCADQEIAHLTASSSH
AAIPAPEEAAEFYMWLQWICDQQLGAAQSAAIDAGMSIGIIADLAVGIHPGGADAQSLAD
SLAPRASVGAPPDNYNQQGQDWSQPPWHPDRLAEASYVPWRDLLRTVLRHAGGIRVDHIL
GLFRLFWIPRMQSPTTGAYVNYDHNALVGVLALEAERAGAVVIGEDLGTYEPWVQEFLAQ
RGIMGTSVLWFESSPTGGPRHQNEYRELALSSVTTHDLPPTAGLLAGEHIELRKELGILT
VDPEQEHEQDIRWQNEILDEVKHTGAFSGATVPETFQGLNRGERGSADTLIPAIHKFLAG
TPSALTCTSLVDLVGDRRAQNQPGTTSDMYPNWCIPLCDGNIQALTIEEIADLPLFQAVA
DASKRNKR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgggttatacagaattgctgcgcgaactcgcagcagcacatgcagtttcttgttcattt
accggattcggcggcgaagtaaccgaagtcagcgacgatacgctggttaaaacacttcgt
gcgttgggtgttcgctttggaaatgaacccgaggacagtccaaacgatcacatgccgctc
gatgctcctatgccgagcgaggaacagatccgtgcagctattcagaagcgccgcgatgaa
gaagacacgcgcccgcttccccgctgcgtcgtcgctacgcaaggagacccttacgtcttc
aacgtacatgttcacgacggctcccccgcagacatcacaatcacgcttgaagacggctca
gtcgcagcagacgtcacccaaattgaaaactggacgccaccgcgcactgtcgacggcatc
acatggggcgaagcctctttccagatcccacaggatctccccttaggctggcacaccatc
acgctgacctccgacacgctcactgccagctgtttcctcattatcaccccgcagcagctc
tccaccgcgcgcacgtttgtggagaacccagccactggagttatggctcagctctattca
gtgcgcagcaatgactcgtggggaatgggagacttccatgacctcggcgagttggccaaa
gttgtggccgacaaagctgacgctgactatattttggtcaacccgatgcatgcagccgag
cccttcccgccagtcgaggactccccttatctccccaccacgcgacgctttattaatccc
atctatatccgcgtggaggacatacccgagtacctcagccttaacgatgagttgcaaaag
gaaatcgaggagatttcttctgagtttaaggctctcaaccactccagcgataaaattgaa
cgcaacccgatctatgacgcaaagctccaagtgcttcatgcaatttttgaggccgagcgc
gatccggcacgtgaacaggacttccgcgattttgtagcctctgaaggtgatggcctctac
gacttcgcgttgtggtgtgcagatcaagaaatcgctcaccttacggcatccagctcccat
gctgctatccccgctccagaggaggccgcagaattctacatgtggcttcagtggatctgc
gatcagcagctaggtgcagcgcaatcggctgctatcgacgcaggcatgagcataggaatc
atcgccgacctcgccgtggggatccaccccggcggtgccgacgcccaaagccttgccgac
tctctagcgccacgcgcatccgtcggcgccccgcctgataattacaatcagcaaggacaa
gactggtctcagccaccatggcatcccgaccgtcttgctgaagccagctacgtgccatgg
cgcgatctgcttcgcaccgtcctgcgtcatgctggaggtattcgagtagaccatatccta
gggcttttccgacttttctggatcccccgcatgcaatcccccaccaccggggcttatgtc
aactacgaccacaatgctctggtcggcgttctcgcgcttgaagcagagcgtgctggcgca
gtagtgataggtgaggacttaggcacatacgagccatgggttcaggagttccttgcacaa
cgcggaatcatgggcacatcggtgctttggtttgagagttcccccacgggtgggccgcgg
caccaaaacgaataccgcgagctcgcgctatcctccgtgaccacgcacgatcttcctcct
accgcgggacttcttgctggcgagcacatcgagttgcgtaaagagctcggtattcttacc
gtcgatcctgagcaagagcatgaacaagatattcgttggcaaaacgagattctcgacgaa
gtcaagcacaccggtgccttctccggggccacagtgccagagactttccaagggctcaat
aggggagaacgaggaagcgcagacacccttataccggctatccacaagttcctagccggc
accccctctgctctcacgtgtacctcgctggtggatcttgtcggcgaccgccgggcccag
aaccagcccggcacaacctccgatatgtatcccaactggtgcatccccctttgcgatggc
aacatccaagccctgaccatcgaggaaatcgctgacctccccttgttccaagcggtagcg
gacgcgtcaaagcggaacaagcgctag

DBGET integrated database retrieval system