KEGG   Corynebacterium pseudotuberculosis 258: Cp258_1647Help
Entry
Cp258_1647        CDS       T02118                                 

Gene name
yddQ
Definition
(GenBank) Isochorismatase family protein
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Cp258_1647 (yddQ)
Enzymes [BR:coe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Cp258_1647 (yddQ)
    3.5.1.-  
     Cp258_1647 (yddQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1814610..1815272
Genome map
AA seq 220 aa AA seqDB search
MSTTLTPFLTPIQRSSMQRVFSYAFCTILVPSQKENMRALIIVDVQNDFCPGGALETVKG
AIQAQSIAEYTASHRGKYDCIAATKDWHIDPGDHFSQTPDFIDSWPVHCIANTEGADFHP
LLSNMHFDEVFYKGHYSAAYSGFEGSTASGELLGEWLKNRGIREIDIAGIATDYCVQATA
LDGLREGFRVTVLSHLCAAVNEDNTHTVLHQLKEHGCVLV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacaacacttaccccctttttaaccccaatacagcgttcttccatgcagcgtgta
ttctcatatgcattttgtactatccttgtgccctctcagaaagaaaatatgcgagccctc
atcattgttgacgtccaaaatgacttttgtccgggaggggcgttagaaacggtcaagggc
gcaatccaagcacaatccattgcagaatacacggcgtctcataggggaaaatacgactgc
atcgcagccaccaaagattggcacattgaccccggcgatcatttttctcagacaccagac
tttattgactcctggcctgtacattgcatagccaacacggaaggcgccgattttcaccca
ttgctctcaaacatgcactttgatgaggttttttataaggggcactatagtgcggcttac
tcggggttcgaggggtccacagcatctggagagttattaggtgaatggttaaagaatcgc
gggatacgcgagattgatatcgcgggaatcgctacggattattgcgttcaggctacggct
cttgacggtttaagagaaggcttccgtgtgacggtgctctcgcatctttgcgccgcagtc
aacgaggacaacacccacacagttttgcatcagcttaaagagcatggatgtgtccttgtt
taa

DBGET integrated database retrieval system