KEGG   Corynebacterium pseudotuberculosis 258: Cp258_1952Help
Entry
Cp258_1952        CDS       T02118                                 

Gene name
nagA
Definition
Beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cp258_1952 (nagA)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cp258_1952 (nagA)
Enzymes [BR:coe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cp258_1952 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2102894..2104003)
Genome map
AA seq 369 aa AA seqDB search
MKRLLAAALLGVLAACSDAGTNTDPTSTEATTALTTQETSAPASAKPQPEDVRAKAASLM
MVGVSNYDDALAALNQGAGGIFIGSGTDPNLLTAPDRNIQALRKAVGRDLSVSTDFEGGR
VLRHQGILGTFPSPQVMAQTMNPEQVRGMAKAMGDSLLAHGVTVNFAPVADIDAGLDVVG
DRAFSADPNIDAEYATAFAQGMLDAGVRPVFKHFPGHGRASGDSHTGQVFTPSLGDLENI
DLVPYGRINIPGAGVMLGHMVVPDLGAPQNGLPSTLNPAAYQLLRTGAYRDGRPFAGVVY
TDDLAMGAITGVMPIPQAVVASLQAGADQALWVTTAGLKEAIDATVAAVETGTYPRAQFE
ESVRRVGVV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacttctcgccgccgccctcctcggtgtgctcgctgcatgtagcgacgccgga
accaatacggatcccaccagcactgaggccaccactgcgttaacaacgcaggaaaccagc
gcgcctgcaagcgcaaaaccacagcctgaggacgtccgcgctaaagccgcgagcctgatg
atggtgggagtaagcaattacgacgacgcccttgctgccctaaaccaaggcgctgggggt
atcttcatagggtccggcaccgatcccaatcttctcaccgctccggatagaaacattcag
gcgctgcgtaaggccgtggggcgagacttgtctgtctcgaccgattttgagggagggcgt
gttctccggcatcagggaattctgggcaccttcccctcgccccaagtgatggcacaaacc
atgaaccccgagcaggttcgagggatggctaaagcgatgggcgactcattgctggctcat
ggagtgaccgtgaattttgctccggtcgcggatatagacgctggattagacgttgtgggc
gatcgtgcctttagcgcagacccaaatattgatgcggaatacgccacagcttttgcccaa
ggaatgcttgatgctggagtccggccagtgtttaagcacttcccggggcatggccgcgcc
agtggcgattcacacacaggacaggtattcacgccctctttaggtgacctggaaaacatt
gacctagttccttatggccggattaatatccccggtgccggcgtgatgctcgggcatatg
gtggttcctgatctaggcgctccccagaacggacttccatccactctcaatccggccgca
taccagttactacgcactggggcttatcgtgatgggcgtcctttcgccggcgtggtctac
acggatgatcttgctatgggagcaatcaccggggttatgcctatccctcaagccgtagtg
gcctcgctgcaagctggcgcagatcaggctttgtgggtgaccactgcggggcttaaagaa
gctatcgacgctaccgtggctgccgtggaaaccggcacgtatcccagggctcaatttgaa
gagtcggtacgccgggttggtgttgtttaa

DBGET integrated database retrieval system