KEGG   Corynebacterium pseudotuberculosis 258: Cp258_2010Help
Entry
Cp258_2010        CDS       T02118                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cp258_2010 (deoA)
Enzymes [BR:coe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cp258_2010 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2179984..2181273
Genome map
AA seq 429 aa AA seqDB search
MAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMAALNMAIFLNGMDREEIV
QWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSGRGLGH
TGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDITATVDC
IPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDAGTNMVALL
TDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVHEALAD
GRAMDSWKKMIRAQGGDPDAALPTARHTHEATADRDGYLTEMDALALGVASWRLGAGRAR
KEDPVQLGAGIEIHAELGEKVSSKGQKLFTLHTDDEDRFSRALESLEPGVNIGDEPPAPR
PSVILDRIS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaaattcgacgccgtagacgtcatccgcacaaagcgggacaacgggaagcta
agcaagggacaaatcgactggatcatcgacgcctacactcgcggcattgttggcgacgat
caaatggctgccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtc
cagtggacccaggccatgatcgactccggcgagaccatgagctttgccagcctctcccgg
ccaacaacagacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcg
ccactcgttgccagttacggcgttgccgtgccacaactctctggtagaggactaggacac
acaggcggaaccctagacaaattagaggccatccccgggtgggaagctgacatagataat
gcccgaatgatgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggc
ctcgcacccgccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgc
atcccgctgatcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaaccta
gtcctcgacgtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgag
ctcgcccgcaccatggttgacctaggccgcgacgccggaaccaatatggtcgcgcttctc
accgacatgtccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtct
gtagaagtcctcgcaggcggtggcccttccgacgtcatagagctcacctgcgcccttgcg
acggagatgcttgagctcgccggcgtccatgaccccgatgtccacgaagcgcttgccgac
ggccgcgcgatggactcttggaagaagatgatccgcgcgcagggcggcgaccccgacgca
gcgctccccaccgcacggcacacccatgaggccaccgccgatcgcgacggctatctcaca
gagatggacgccctcgcactgggagtagccagctggcgactcggcgcaggacgcgcacgc
aaggaagatccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaag
gtttcatcaaagggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagc
cgagccctagaatccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgc
ccctcggtcatccttgatcgcatcagctaa

DBGET integrated database retrieval system