KEGG   Corynebacterium pseudotuberculosis 258: Cp258_2111Help
Entry
Cp258_2111        CDS       T02118                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cp258_2111 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp258_2111 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp258_2111 (trpA)
Enzymes [BR:coe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp258_2111 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2345214..2346053
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPSPEASLSIIRTAVSAGADALELGIPFSDPVAD
GPTIQRSHLRALDNGATVDSSLKLISHIRSEFPELPIGLLIYGNVPFTRGLDSFYQEFAA
AGADSILLPDVPVREGGAFIAAAQRARIAPIFIAPAQASEETLHAVATHSEGYIYAISRD
GVTGTERESSTSGLTDVVNNINKFGGAPVLLGFGISTPQHVREAIDAGARGVITGSAITA
IIERHCIGQHPAPATIDDMSALQSEIFAFISEMKAATRR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaatctttttacccggctagaacaatccaatgagggcgcctttgtt
cccttcatcatgcttggagaccccagccctgaagcatcattatcaatcatccgtaccgcc
gtcagtgccggcgcagacgcccttgagcttgggatcccattctcagacccagtagctgac
gggcctaccattcagcgttctcatctccgcgccctggataatggggcaacggttgattcc
tcattaaagctcatctctcacattcgttcagaattccccgaactacccatcggcctcttg
atttatggcaacgttccttttacccgtggactagatagcttctatcaagaatttgccgca
gccggcgccgattccattttgcttcccgacgttcccgtgagggaggggggagccttcatc
gcagcggcacagagagcgagaatcgcacccattttcatcgccccggcacaggcttctgaa
gagaccctccatgcagtagcaacacattccgagggatacatctatgcaatttctcgtgat
ggagttaccggaacggaacgagaatcttccaccagtggtctcaccgatgtggtaaacaac
atcaataaattcggcggagcgccggtacttctagggttcggaatttccacgcctcagcat
gtccgtgaagcgatagatgccggcgccaggggagtaatcactggatccgcaatcactgcg
attattgaaagacactgcatcggccaacatcctgcacccgcaacaatcgatgacatgtct
gcactgcaatcggagattttcgctttcatctcagaaatgaaagcggcgacccgcagataa

DBGET integrated database retrieval system