KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0264Help
Entry
CpCIP5297_0264    CDS       T02054                                 

Gene name
gpmA
Definition
(RefSeq) Phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpCIP5297_0264 (gpmA)
   01230 Biosynthesis of amino acids
    CpCIP5297_0264 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpCIP5297_0264 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CpCIP5297_0264 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpCIP5297_0264 (gpmA)
Enzymes [BR:coi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CpCIP5297_0264 (gpmA)
Exosome [BR:coi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CpCIP5297_0264 (gpmA)
  Exosomal proteins of melanoma cells
   CpCIP5297_0264 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
267782..268528
Genome map
AA seq 248 aa AA seqDB search
MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDVLPTVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGADQFMEWRRSYG
TPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYFEEEILPRAKKGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKVLNPGGTYLDPEAAAAGAA
AVAAQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactatcggaaaactgattcttctccgccacggacaaagcgagtggaacgcctccaac
cagttcacgggttgggtggacgttaaccttactgagcaaggcgaggccgaggccaagcgc
ggcggcgagatgctgaagcaacaagatgttttgccaactgttgtctatacttctcttctt
cgtcgtgcaatccgcaccgccaacatcgcacttaacgcggcggatcgtcattggatcccg
gttgtgcgcgattggcgcctcaacgagcgtcactatggtgcgttgcagggtctgaacaag
gctgagaccaaggataagtatggcgcagatcagttcatggaatggcgccgttcttacggc
acccctcctccggagttggaagactcaagtgagttttctcaggcaaacgacccccgctac
gccgatctgtctcaagttcctcgcacggaatgcctcaaggacgttgtagaacgttttgtg
ccttattttgaagaggaaattttgccacgggcgaaaaagggcgagactgtcctcatcgca
gcgcatggtaattccttgcgtgcattggtcaaacaccttgacaatatctcggatgcagat
atcgcggagctgaatattcctaccggaattccgctggtatacgagctggaccaggaagga
aaggttcttaacccgggtggtacctaccttgatccagaggcagcggcagcaggagctgcg
gcagttgctgcgcaaggcggcaaataa

DBGET integrated database retrieval system