KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0496Help
Entry
CpCIP5297_0496    CDS       T02054                                 

Gene name
rbsK
Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CpCIP5297_0496 (rbsK)
Enzymes [BR:coi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CpCIP5297_0496 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(502580..503482)
Genome map
AA seq 300 aa AA seqDB search
MLKTVAVVGSINADLSVRVHRPPTPGETVLGMDSSISPGGKGANQAVAAALQGAKVVFIG
AVGKDSYAEPAMELLRASSVSLEHVSAVDGPTGSAVITVSDDGENSIIVIPGANAAVDAA
YVAKNAEAIAGADIVLLQGEIPADGFLEAIKAATGRIVVNLAPVISVDREALLKADPLMA
NEHEANLILEQLGSSISSDDPHELAQELLAQGFASVVLTLGSKGALVADPQASVIVPSPK
VTAVDTTGAGDAFAGAFVAQLLSGASSVEAAQHAVRVAAYAVQYRGTQVSYPNAGAELPR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagactgttgccgtcgtaggctccatcaatgcagatttgagcgtgcgtgttcac
cggcctcctacgccgggagagaccgtcctcggcatggatagttccatttctcccggtgga
aaaggcgcgaatcaggcagtagcagcagcactccaaggtgcaaaagttgtcttcatcggc
gctgtaggtaaagattcctacgccgaacccgctatggagttgctgcgcgcctccagcgta
tctctagaacatgtctcggctgtcgacggccccacgggcagcgcagtaatcacagtttct
gatgacggagagaactccatcatcgtgatccctggcgcaaatgctgctgtcgacgccgct
tatgtggccaaaaatgcagaagctatcgcaggtgcggacattgtacttcttcagggagag
attcctgccgatggattcctcgaagcgataaaagcagcaactggtcgcattgtggtcaac
cttgctcccgttatatccgtggatcgtgaagctttgctcaaagcagacccactcatggct
aacgagcatgaagccaacctcattctggagcaactgggcagcagcatcagcagcgatgac
ccgcacgagctcgctcaagaattgttagcccagggttttgcctcggttgttctcactcta
ggtagtaaaggcgcgcttgtggcagatcctcaggccagcgtcatagttccgtcaccaaag
gtaaccgcagtggacacaactggagctggggatgccttcgctggcgcctttgtggcccaa
ttgctcagcggggcgtcttctgtagaagctgcacagcacgccgtccgggtcgccgcctat
gccgtgcagtatcgaggcacccaggtctcctaccctaacgcgggcgccgaactcccgcgt
tag

DBGET integrated database retrieval system