KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0622Help
Entry
CpCIP5297_0622    CDS       T02054                                 

Gene name
echA6
Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00071  Fatty acid degradation
coi00280  Valine, leucine and isoleucine degradation
coi00310  Lysine degradation
coi00360  Phenylalanine metabolism
coi00380  Tryptophan metabolism
coi00410  beta-Alanine metabolism
coi00627  Aminobenzoate degradation
coi00640  Propanoate metabolism
coi00650  Butanoate metabolism
coi00903  Limonene and pinene degradation
coi01100  Metabolic pathways
coi01110  Biosynthesis of secondary metabolites
coi01120  Microbial metabolism in diverse environments
coi01130  Biosynthesis of antibiotics
coi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpCIP5297_0622 (echA6)
   00650 Butanoate metabolism
    CpCIP5297_0622 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    CpCIP5297_0622 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpCIP5297_0622 (echA6)
   00310 Lysine degradation
    CpCIP5297_0622 (echA6)
   00360 Phenylalanine metabolism
    CpCIP5297_0622 (echA6)
   00380 Tryptophan metabolism
    CpCIP5297_0622 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpCIP5297_0622 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CpCIP5297_0622 (echA6)
   00281 Geraniol degradation
    CpCIP5297_0622 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CpCIP5297_0622 (echA6)
   00627 Aminobenzoate degradation
    CpCIP5297_0622 (echA6)
   00930 Caprolactam degradation
    CpCIP5297_0622 (echA6)
Enzymes [BR:coi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CpCIP5297_0622 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEQ06168
Position
671040..671876
Genome map
AA seq 278 aa AA seqDB search
MLEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALASGFAAIQGDHAAAVAFAHEVAGLAPLSVRQLKSALNYGEAN
YSLDERSQSLFSQCWSSQDMREARQARLEKRVPQFKGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggcgctgggatgcagcttgct
ttggcgtgtgatctccgcgttgttggggagtctgcatggtttaaagtccccgctgtttct
ttgggctttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcgttgaccccggatgcggctctggctagt
ggttttgccgcaattcagggggaccatgccgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggcagctcaagtcggcgcttaattatggggaggctaat
tactcgttggatgagcgctcacaatccttattttcccagtgctggtctagtcaggatatg
agggaagcgcgacaggcgagactggagaaacgagttccccaatttaaggggcgataa

DBGET integrated database retrieval system