KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0622Help
Entry
CpCIP5297_0622    CDS       T02054                                 

Gene name
echA6
Definition
(RefSeq) Enoyl-CoA hydratase echA6
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CpCIP5297_0622 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpCIP5297_0622 (echA6)
   00650 Butanoate metabolism
    CpCIP5297_0622 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    CpCIP5297_0622 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpCIP5297_0622 (echA6)
   00310 Lysine degradation
    CpCIP5297_0622 (echA6)
   00360 Phenylalanine metabolism
    CpCIP5297_0622 (echA6)
   00380 Tryptophan metabolism
    CpCIP5297_0622 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpCIP5297_0622 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CpCIP5297_0622 (echA6)
   00281 Geraniol degradation
    CpCIP5297_0622 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CpCIP5297_0622 (echA6)
   00627 Aminobenzoate degradation
    CpCIP5297_0622 (echA6)
   00930 Caprolactam degradation
    CpCIP5297_0622 (echA6)
Enzymes [BR:coi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CpCIP5297_0622 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
638717..639550
Genome map
AA seq 277 aa AA seqDB search
MLEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALASGFAAIQGDHAAAVAFAHEVAGLAPLSVRQLKSALNYGEAN
YSLERSQSLFSQCWSSQDMREARQARLEKRVPQFKGR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggcgctgggatgcagcttgct
ttggcgtgtgatctccgcgttgttggggagtctgcatggtttaaagtccccgctgtttct
ttgggctttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcgttgaccccggatgcggctctggctagt
ggttttgccgcaattcagggggaccatgccgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggcagctcaagtcggcgcttaattatggggaagctaat
tactcgttggagcgctcacaatccttattttcccagtgctggtctagtcaggatatgagg
gaagcgcgacaggcgagactggagaaacgagttccccaatttaaggggcgataa

DBGET integrated database retrieval system