KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0795Help
Entry
CpCIP5297_0795    CDS       T02054                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CpCIP5297_0795 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    CpCIP5297_0795 (dapE)
Enzymes [BR:coi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CpCIP5297_0795 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817977..819050
Genome map
AA seq 357 aa AA seqDB search
MLDLTADPIELTRALVDIESLSHHEEHIADLIEQALKSIPNVEVLRHGNTVVGRTHRGLG
SRVILAGHIDTVPTADNVPSTLIDDVLFGCGTVDMKSGMAVYLHAFATLANSQELAQDLT
IVCYEGEEVSSEYNGLGHLQQAHPEWLQGDIALLGEPSGAVIEAGCQGSIRLRITAHGVR
AHSARSWLGTNAMHLLAPVISRIANYEAQEKLVDACLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPDRSLDDAMEHLLETLSLPSGVSYEVDDAVPGARPGLDRPAAVSLLRATGG
KFRAKYGWTDVSRFSEMGIPAVNFGPGDPSYCHKKDEQCPVHMITDVSNTLLDYLRT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttggacttgactgctgaccctattgaattaacccgtgcactggtggacattgaaagc
ctctctcaccacgaggagcatattgcggatctgatcgaacaggccttgaagtccattcct
aacgtagaggtactgcgtcatgggaataccgtggttgggcgcacccatcggggactagga
agcagagttatcctagccgggcacatcgacaccgtacccacagcagataatgttccttcc
actctcatcgatgacgtactttttggctgtggaaccgtcgacatgaaatccggcatggct
gtatatctgcatgcttttgccacccttgctaattcccaagaattagcacaagaccttacg
atcgtttgctatgaaggcgaggaagtctccagcgaatacaacggattaggtcatctgcaa
caagcacaccctgaatggcttcaaggtgatatcgccttactaggagagccatcaggagca
gtcatcgaagcaggatgtcaaggatctattcgtctccggatcacggcgcacggtgtgcga
gcgcattctgcgcgttcgtggctaggaacgaacgccatgcatctcctagcgcctgttatc
tcccgtatcgcgaattatgaggctcaggaaaaacttgtcgacgcctgcctctaccacgag
gggctcaacatcgtgcactgtgaatctggtgtagccactaacacgattcccgatgaagcc
tggatgtttgtaaacttccgttttgccccggaccgcagcctggacgatgcgatggagcat
ttgctggagaccctctcccttcctagcggggtgagctatgaggtggatgacgcggtgccg
ggagcgcggccgggactggaccgtccggctgctgtctctctcctacgcgcaacgggcgga
aaatttcgtgctaaatatggttggactgatgtgtctcgtttttctgaaatgggaattcct
gcagtgaattttggcccgggtgacccctcgtactgccataagaaagacgagcagtgcccg
gttcacatgatcacagacgtctccaacactttgttggactaccttcgtacctag

DBGET integrated database retrieval system