KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0797Help
Entry
CpCIP5297_0797    CDS       T02054                                 

Gene name
folP
Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CpCIP5297_0797 (folP)
Enzymes [BR:coi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CpCIP5297_0797 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
819843..820700
Genome map
AA seq 285 aa AA seqDB search
MPRSAFLGTEGLATVMAIVNRTPDSFYDHGATHAFDAAIKRAGAVIAAGAGIVDIGGVKA
GPGEFVSISEEIDRVVPVIAAVHEAFPETIISVDTWRAKVAELAVDAGAALINDTWAGYD
PELVEVAGDRRVGYICSHTGGVVPRTRPYRVHYDDVVHAVIDETTRQAEHAVSLGVPEDK
IFIDPTHDFGKNTFHGLELLRRIDEIVATGWPVLMALSNKDFIGETLARNVDKRVPGTLA
ATAWSAERGVAAFRSHQVEETIDVIRMTAAIQGTVSPLKTTRGLA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggagcgccttcctaggcactgaaggcttagctacggtgatggcgatcgtaaat
aggacgcccgattccttttacgatcatggtgcaactcatgcttttgatgccgcaatcaag
cgtgcaggagcagtgattgcagccggtgccgggatcgtggatatcggcggggtcaaagct
gggccaggtgagtttgtttccatttctgaagaaatagaccgtgtggtgccggtgatcgct
gcggtgcacgaggctttccccgagacaatcatttcggtggatacctggcgcgcaaaagtc
gccgagttagccgtcgacgcaggcgccgcgctcatcaacgacacctgggccggctacgat
ccagaactcgtagaagtcgctggagatcgtcgagttggatatatctgctcacacaccggc
ggcgtggtccctaggacaaggccgtatcgcgtgcattacgacgacgtagtgcatgcggtt
atcgatgaaaccacgcggcaagcggagcacgcagtgtccctaggagtaccagaagacaag
atattcatcgatcccactcatgactttggcaaaaacaccttccacggacttgagcttcta
cgccgaatcgacgaaatcgtggccaccggatggcctgtcctcatggctctgtccaataag
gattttattggagaaacgcttgctcggaacgtcgataagcgagtacctggcaccttggca
gcaacagcatggtctgcggagcgaggcgtggcggcgtttcgttcgcatcaagtggaagaa
acaattgacgtgattcggatgactgcggcgattcaaggaacggtttctccgctgaaaaca
actaggggtttggcgtga

DBGET integrated database retrieval system