KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0874Help
Entry
CpCIP5297_0874    CDS       T02054                                 

Gene name
glgB
Definition
Glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CpCIP5297_0874 (glgB)
Enzymes [BR:coi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CpCIP5297_0874 (glgB)
Exosome [BR:coi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpCIP5297_0874 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(901458..903656)
Genome map
AA seq 732 aa AA seqDB search
MFSASDPIRIDDDVLGRLRYCQFHDPHGVYGCHRIDDSRAIIRTRQLGAEAVTVTLTDGT
TYALSPIGDDIFAATVDASLSSDYRLNVSWPGDTMVTTADPYHFLPTLGELDIHLIREGR
HERLWDVLGAHVRTFTTDLGEVTGTSFAVWAPNATGVAVVGDFCGWNPNQYPMRSLGDSG
VWELFIPGIQAGDVYKYAIHTREGHRIDKADPLARHAEVAPATGSIVADSSYEWNDADWM
SQRATRDHATQPMSIYECHLGSWRENRTYKDLASELVDYVSALGYTHVEFLPVAEHPFGG
SWGYQVSGYYAPTSRWGTPDELRMLIDAFHRAGIGVIMDWVPAHFPKDSFALGRFDGEAL
YEHPDWRRGEQKDWGTYVFNFGRNEVRNFLVANALYWIDEFHVDGLRVDAVASMLYLDYS
REAGEWLPNVYGGRENLEAVQFLQEMNATVHKTFPGVLTIAEESTSWPGVTTPTDHNGLG
FSMKWNMGWMNDTLEYFSLDPIHRAYHHNEITFSMVYAYSERFVLPFSHDEVVHGKGSLW
TRMPGDAWNKASGLRALYAYMYAHPGRKLLFQGQEFGQVMEWSEGRSLDWDNLVGWEGEY
HEGLIKLIRDLNFVYQDNPALYTQDNGPEGFSWAKSNDAGNNILSFIRYGSAGEKILAVF
NFSGSSQPHYKLGVPEGGRWECILNTDAGVYEGANNLLEQTVTAWDTEWDGYEHSLTVHI
PAMSGQFYRWID
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgcttctgatcccatccgcatcgacgatgatgttcttggccggctgagatac
tgtcagttccatgacccccacggggtctatggttgccaccgtatcgatgactcccgtgct
atcatccgtactcgccaacttggcgcggaagctgtcacagtcacgctcacagatggaaca
acatatgcgctttcccccatcggggatgatatattcgcagccaccgtagacgcgtctctg
tccagcgactataggctcaacgtctcgtggcccggagacacaatggtgaccactgctgat
ccttatcatttccttcctacgctgggagaactagatattcatctcatccgagagggaagg
catgaacgcctctgggatgttctaggggcacatgttcgcacttttaccacggatctaggt
gaggtaacaggcacatcctttgccgtatgggcgcccaatgccacaggagttgctgttgtt
ggcgatttttgtggatggaaccccaaccaataccccatgcgctcgctaggagactcaggt
gtctgggaactatttattccgggtattcaagctggagacgtgtacaaatacgcaattcat
acccgcgaggggcatcggatagacaaagccgacccgctagcgcgccatgcagaagtagcg
cctgctacggggtccatcgtcgcagattccagttatgaatggaatgacgcggactggatg
tctcaacgcgcaactcgcgaccatgcaacgcaaccgatgagcatctacgagtgccatctg
ggctcttggagagaaaaccggacgtataaagacctcgcctcagaactggtcgactacgtt
tctgctctcggatacacccacgtagagttccttcccgtggcagagcacccctttggtgga
tcttgggggtaccaggtctctggctactacgcccccacatcgcgctggggaaccccagat
gagctccgcatgcttatcgacgctttccaccgcgctggcatcggagtcattatggactgg
gtacccgcgcatttccccaaagattcttttgctctgggacgcttcgacggtgaggcgctc
tacgaacaccctgactggcgtcgaggagagcaaaaagattggggcacctatgtctttaat
ttcgggcgcaatgaagtccgcaatttcctggtagctaacgcactttattggatagatgaa
ttccatgtcgatggtctacgtgtggacgccgttgcgtcaatgctctatctcgactactcc
cgagaggccggcgaatggctaccaaatgtctatggaggccgtgaaaatctcgaggcagtc
caattcctgcaggagatgaacgccactgtgcataagaccttccctggtgttcttaccatc
gcggaagaatcgacttcttggcctggagttaccactcctactgaccacaatggccttggt
tttagcatgaagtggaacatgggctggatgaatgacacccttgagtatttctctttggac
cccattcatcgcgcttatcaccacaatgagattacgttctctatggtctatgcctattca
gaacgttttgttcttccgtttagtcatgacgaagtagtccacggcaagggatcgctatgg
actcggatgcctggtgacgcatggaacaaagccagcggattacgcgccctctacgcctat
atgtacgctcacccaggcagaaagctgttgttccaaggacaagagtttggtcaggtcatg
gaatggtctgaggggcgctctcttgattgggataaccttgtagggtgggaaggcgagtat
cacgaggggttgataaagctcatccgcgatctcaactttgtgtaccaagacaaccctgcg
ctctatacccaggataatggccctgaaggctttagctgggctaagtccaatgatgcaggc
aacaatatcttatctttcatccgctatggttctgccggagaaaaaattcttgcagtattt
aacttcagcgggagctctcagccacattacaagctgggggtaccggaaggcggacgttgg
gaatgcatactcaacaccgatgcgggcgtatatgaaggcgctaataatcttctggaacaa
actgttaccgcctgggacaccgagtgggacgggtacgagcattccctcacagttcatatt
cctgcgatgagtggtcaattttatcgctggatagactaa

DBGET integrated database retrieval system