KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0897Help
Entry
CpCIP5297_0897    CDS       T02054                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructo kinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00010  Glycolysis / Gluconeogenesis
coi00030  Pentose phosphate pathway
coi00051  Fructose and mannose metabolism
coi00052  Galactose metabolism
coi00680  Methane metabolism
coi01100  Metabolic pathways
coi01110  Biosynthesis of secondary metabolites
coi01120  Microbial metabolism in diverse environments
coi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpCIP5297_0897 (pfkA)
   00030 Pentose phosphate pathway
    CpCIP5297_0897 (pfkA)
   00051 Fructose and mannose metabolism
    CpCIP5297_0897 (pfkA)
   00052 Galactose metabolism
    CpCIP5297_0897 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CpCIP5297_0897 (pfkA)
Enzymes [BR:coi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CpCIP5297_0897 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CpCIP5297_0897 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEQ06436
Position
960194..961222
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAEIDALIPIGGEGTLKGAQWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEHPFDINEICKAMERRFQMGEKYGIIVVAEGALPKEGTMSFAQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVPAARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctctggtggcgattgccccggactcaacgctgtcatccgc
ggtatcgtccgcacctgttccgaatacggttctaccgttgtgggatatgaggacggttgg
gttggtcttatggaagacaagcgcattcaactttacgatgatgaaaatattgatcgtatt
cttttgcgcggcggaacgatcttgggaactggccgccttcaccccgataagttcaaggca
ggacttgagcaaatcaaagagaatttagcagacgccgaaattgatgctttgattccgatt
ggtggcgaaggcacgctaaagggagcccaatggctttctgataatgggatccctgtggtg
ggcgttcccaaaactatcgataatgatgtcaatggtaccgattacacctttggctttgac
accgcagtgtcggtagcaactgacgcaattgatcgtttacataccaccgcagaatcccac
aatcgcgtgatgatcgtggaagtgatggggcgtcatgtcgggtggatcgcattgcatgcg
gggatggcaggcggagcacactacactgtgattccagagcatccttttgatatcaatgag
atctgcaaagcgatggaacgccgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggggctttgcctaaggaaggaacgatgagttttgcccaggggtgcgtagaccaa
tttgggcatcaaacctttaatggcatcggccaggtgatcggcgaagaaataaagaggcgc
ctaggtcatgacgtacgtactactgtgctcggacacatccaacgcggcggtactccgact
gcttatgatcgtgttttggcaacccggtatggtgttcacgctgcccgtgcttgccataca
caagactttggcaagatggtggcacttcatggtgagcatattgacctaattcctttggaa
gaagcagtaggaactttgaaggtagttcctgcggctagatatcggacagccagagctctc
tttggataa

DBGET integrated database retrieval system