KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_1150Help
Entry
CpCIP5297_1150    CDS       T02054                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:coi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:coi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1224869..1225810)
Genome map
AA seq 313 aa AA seqDB search
MKHLLSIADLSKDEILGIMDEADRFREALTGREIKKLPTLRGRTIFTLFYENSTRTRSSF
ETAGKWMSADVINISASSSSVKKGESLKDTGLTLSAIGADAIIIRHPSSGAAQQLAQWVA
PEGHGPSVINAGDGSHQHPTQALLDAITIRQRLGNIEGRKIVIVGDCLHSRVVRSNVDLL
TCLGAEVVLVAPPTLLPTGIEQWPVRYSYTMDAEIKDADAVMMLRVQQERMHGGFFPSHR
EYASLYGMSKEREARLQDHAIVMHPGPMLRGMEINYAVADAPRTAVLQQVNNGVHTRMAV
LFTLIAGTNTPGF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatcttttatctatcgcagacctcagcaaagatgagattctcggaatcatggat
gaggccgatcgcttccgcgaggcgcttaccggacgagagattaaaaagcttcctaccctt
cgcggtcggactatcttcaccttgttctacgagaattccacgaggactcgctcttctttt
gaaaccgccggaaaatggatgagcgctgatgttattaacatttcagctagttcttcttcc
gtgaaaaagggggaatccctcaaagatactggtttgactctctccgctatcggagctgac
gccatcataatccgccatccttcttccggcgcagctcagcaattagcacaatgggtggct
ccggaggggcacgggcctagcgttattaacgccggcgatggttctcaccagcaccctaca
caggcgcttctcgacgccattacgatccggcagcggctcggaaacatcgaaggacgcaaa
attgttattgtgggggactgccttcattctcgtgtagtccgttctaatgtagatcttctt
acctgtttgggggcggaagtggtgcttgtagcacctcctacactgttgcccacgggcata
gaacaatggcctgttcgttactcgtacacgatggatgcagagattaaagacgcagatgca
gtaatgatgctccgagtacagcaggagcgtatgcatggcggatttttcccgtcacaccgc
gaatatgcatcgctgtatggaatgtctaaggagcgtgaggcacgacttcaagatcacgca
atagttatgcatcccggaccaatgctgcgaggtatggaaattaattacgccgtagctgat
gcgcctcgtacagccgtgctccagcaagtaaataacggcgtgcatacccgaatggcagtt
ctgtttaccctcatcgccggtacaaatacccccggtttctaa

DBGET integrated database retrieval system