KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_1314Help
Entry
CpCIP5297_1314    CDS       T02054                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:coi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1397408..1398496)
Genome map
AA seq 362 aa AA seqDB search
MGTCGRTLYPYPFSAVVGQERLRLALLLCAISPRIGGVVIRGEKGTAKTTTVRAFARLLG
EAPLVDLPIGATEDRVVGSLDMETVLTTGKARYNPGLLSQADGGVLYVDEVNLLADHLVD
SLLDAAATGQVTVERDGISYSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVMASKDTD
VRAEIMRRRLAFESAPQSFAQAWSHEDASTALQIQKAKQRVQQLQLSNVNLNRIAHLCAA
FDVDGMRADLVIARTALAHAAWRGASMVEDEDIRVAAELALPHRRRRDPFDEPGLDQEQL
DQEMEKARDQHPDASDKAEESQCEKEQHGLENKSSETQSEQPTSDGQEECATTGAPFRST
GA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctgtggacgcacactatatccttatcctttctctgcagtagtagggcaggag
cgattaagacttgcactactcttatgcgcaatttctccgcgtattggtggtgtagttatc
cgcggggaaaagggaacagcgaagaccactacggtgcgagcttttgcgcgtttgctagga
gaagcccctttagttgatctccctatcggtgccacagaggatcgagtcgtggggtccctg
gatatggagacagtcttgaccaccggaaaagctcgctataacccgggcttgcttagtcaa
gcagacggtggggtgttgtacgtcgatgaggtaaatctcctcgcagatcacctcgtcgat
tcgctcttagacgcggcggcaacgggacaagtaacagttgaacgggatggcatttcttat
tcttctcctgccaactttgtgctcgtggggacaatgaacccagaagaaggcgagttgcgg
ccgcaattgcttgatcgtttcggattggctgttgacgttatggcgtccaaagacactgat
gtacgagcagaaataatgcggcgtcggcttgctttcgaatcagccccgcaatcttttgct
caagcgtggtcccatgaggatgcatcgacggcgctgcaaatacagaaggcgaaacaacga
gtgcagcagttacaactttctaacgttaatctgaaccggatcgcacatttgtgtgcagca
tttgacgtggacggtatgagagctgatttggttatcgctcgaactgcgctagcacatgct
gcctggcgcggagcttcaatggttgaagatgaggatatccgggtagccgcagagttggcc
ttgccgcatcgccgtcgcagagacccattcgatgagcctggcctagaccaggaacagctg
gatcaagaaatggaaaaagcccgggatcagcaccctgacgccagtgataaagcggaagag
tctcagtgtgaaaaagagcagcatggactagagaacaagtcttcggagactcaatctgag
cagcccaccagtgacggtcaggaggaatgcgctactactggcgctccctttcgctccacg
ggtgcttaa

DBGET integrated database retrieval system