KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_1651Help
Entry
CpCIP5297_1651    CDS       T02054                                 

Gene name
yddQ
Definition
Isochorismatase family protein yddQ
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CpCIP5297_1651 (yddQ)
Enzymes [BR:coi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CpCIP5297_1651 (yddQ)
    3.5.1.-  
     CpCIP5297_1651 (yddQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1765860..1766474
Genome map
AA seq 204 aa AA seqDB search
MQRVFSYAFCTILVPSQKENMRALIIVDVQNDFCPGGALETVKGAIQAQSIAEYTASHRG
KYDCIAATKDWHIDPGDHFSQTPDFIDSWPVHCIANTEGADFHPLLSNMHFDEVFYKGHY
SAAYSGFEGSTASGELLGEWLKNRGIREIDIAGIATDYCVQATALDGLREGFRVTVLSHL
CAAVNEDNTHTVLHQLKEHGCVLV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgtattctcatatgcattttgtactatccttgtgccctctcagaaagaaaat
atgcgagccctcatcattgttgacgtccaaaatgacttttgtccgggaggggcgttagaa
acggtcaagggcgcaatccaagcacaatccattgcagaatacacggcgtctcatagggga
aaatacgactgcatcgcagccaccaaagattggcacattgaccccggcgatcatttttct
cagacaccagactttattgactcctggcctgtacattgcatagccaacacggaaggcgcc
gattttcacccattgctctcaaacatgcactttgatgaggttttttataaggggcactat
agtgcggcttactcggggttcgaggggtccacagcatctggagagttattaggtgaatgg
ttaaagaatcgcgggatacgcgagattgatatcgcgggaatcgctacggattattgcgtt
caggctacggctcttgacggtttaagagaaggcttccgtgtgacggtgctctcgcatctt
tgcgccgcagtcaacgaggacaacacccacacagttttgcatcagcttaaagagcatgga
tgtgtccttgtttaa

DBGET integrated database retrieval system