KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_1748Help
Entry
CpCIP5297_1748    CDS       T02054                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CpCIP5297_1748
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CpCIP5297_1748
Enzymes [BR:coi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CpCIP5297_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1872391..1872864)
Genome map
AA seq 157 aa AA seqDB search
MTNFFDIPVTLNDATETTMNDWAGHCLMIVNTASRCGLTPQYEALEELYRDYAPRGFFVI
AMPCNQFAEEEPGSNKQIAEFCKREYGVTFPILEKADVNGENTHPLYQFLKGDGPDIEWN
FEKFVVSPEGKVVGRFAPNMEPDDLKIIECLEDNVVL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacttctttgatattccggtgacgcttaatgatgccaccgagacaaccatgaat
gattgggcagggcattgcctcatgatcgtgaacaccgcatctcggtgtggtctgactcct
caatatgaagccctggaggagttgtatcgggattatgcgccacgcggattttttgtgatt
gcgatgccttgcaaccagtttgctgaggaagaacctggatccaataaacagatagcagag
ttctgcaagcgggaatatggcgtgactttcccgattcttgaaaaagcagacgttaacggg
gagaacacacatccgctgtaccaattcttaaaaggagatggccccgatatcgagtggaac
tttgaaaagtttgtggtctcgcctgaaggaaaggtcgtagggcggttcgctccgaatatg
gagccggatgatttgaagatcatcgagtgcttggaagacaacgtggtgctttag

DBGET integrated database retrieval system