KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_1962Help
Entry
CpCIP5297_1962    CDS       T02054                                 

Gene name
nagA
Definition
(GenBank) Beta-N-acetylglucosaminidase
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CpCIP5297_1962 (nagA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CpCIP5297_1962 (nagA)
Enzymes [BR:coi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CpCIP5297_1962 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2157622..2158731)
Genome map
AA seq 369 aa AA seqDB search
MKRLLAAALLGVLAACSDAGTNTDPTSTEATTALTTQETSAPASAKPQPEDVRAKAASLM
MVGVSNYDDALAALNQGAGGIFIGSGTDPNLLTAPDRNIQALRKAVGRDLSVSTDFEGGR
VLRHQGILGTFPSPQVMAQTMNPEQVRGMAKAMGDSLLAHGVTVNFAPVADIDAGLDVVG
DRAFSADPNIDAEYATAFAQGMLDAGVRPVFKHFPGHGRASGDSHTGQVFTPSLGDLENI
DLVPYGRINIPGAGVMLGHMVVPDLGAPQNGLPSTLNPAAYQLLRTGAYRDGRPFAGVVY
TDDLAMGAITGVMPIPQAVVASLQAGADQALWVTTAGLKEAIDATVAAVETGTYPRAQFE
ESVRRVGVV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacttctcgccgccgccctcctcggtgtgctcgctgcatgtagcgacgccgga
accaatacggatcccaccagcactgaggccaccactgcgttaacaacgcaggaaaccagc
gcgcctgcaagcgcaaaaccacagcctgaggacgtccgcgctaaagccgcgagcctgatg
atggtgggagtaagcaattacgacgacgcccttgctgccctaaaccaaggcgctgggggt
atcttcatagggtccggcaccgatcccaatcttctcaccgctccggatagaaacattcag
gcgctgcgtaaggccgtggggcgagacttgtctgtctcgaccgattttgagggagggcgt
gttctccggcatcagggaattctgggcaccttcccctcgccccaagtgatggcacaaacc
atgaaccccgagcaggttcgagggatggctaaagcgatgggcgactcattgctggctcat
ggagtgaccgtgaattttgctccggtcgcggatatagacgctggattagacgttgtgggc
gatcgtgcctttagcgcagacccaaatattgatgcggaatacgccacagcttttgcccaa
ggaatgcttgatgctggagtccggccagtgtttaagcacttcccggggcatggccgcgcc
agtggcgattcacacacaggacaggtattcacgccctctttaggtgacctggaaaacatt
gacctagttccttatggccggattaatatccccggtgccggcgtgatgctcgggcatatg
gtggttcctgatctaggcgctccccagaacggacttccatccactctcaatccggccgca
taccagttactacgcactggggcttatcgtgatgggcgtcctttcgccggcgtggtctac
acggatgatcttgctatgggagcaatcaccggggttatgcctatccctcaagccgtagtg
gcctcgctgcaagctggcgcagatcaggctttgtgggtgaccactgcggggcttaaagaa
gctatcgacgctaccgtggctgccgtggaaaccggcacgtatcccagggctcaatttgaa
gagtcggtacgccgggttggtgttgtttaa

DBGET integrated database retrieval system