KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_2019Help
Entry
CpCIP5297_2019    CDS       T02054                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00240  Pyrimidine metabolism
coi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CpCIP5297_2019 (deoA)
Enzymes [BR:coi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CpCIP5297_2019 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2
Motif
Other DBs
NCBI-ProteinID: AEQ07515
Position
2234614..2235954
Genome map
AA seq 446 aa AA seqDB search
MPYSTSPALTAPMEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMA
ALNMAIFLNGMDREEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLV
ASYGVAVPQLSGRGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAP
ADKKIYALRDITATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELAR
TMVDLGRDAGTNMVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEM
LELAGVHDPDVHEALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEATADRDGYLTEMD
ALALGVASWRLGAGRARKEDPVQLGAGIEIHAELGEKVSSKGQKLFTLHTDDEDRFSRAL
ESLEPGVNIGDEPPAPRPSVILDRIS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgccatatagcacttccccagccttaacagctccaatggaaggtgataccgtggccgag
aaattcgacgccgtagacgtcatccgcacaaagcgggacaacgggaagctaagcaaggga
caaatcgactggatcatcgacgcctacactcgcggcattgttggcgacgatcaaatggct
gccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtccagtggacc
caggccatgatcgactccggcgagaccatgagctttgccagcctctcccggccaacaaca
gacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcgccactcgtt
gccagttacggcgttgccgtgccacaactctctggtagaggactaggacacacaggcgga
accctagacaaattagaggccatccccgggtgggaagctgacatagataatgcccgaatg
atgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggcctcgcaccc
gccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgcatcccgctg
atcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaacctagtcctcgac
gtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgagctcgcccgc
accatggttgacctaggccgcgacgccggaaccaatatggtcgcgcttctcaccgacatg
tccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtctgtagaagtc
ctcgcaggcggtggcccttccgacgtcatagagctcacctgcgcccttgcgacggagatg
cttgagctcgccggcgtccatgaccccgatgtccacgaagcgcttgccgacggccgcgcg
atggactcttggaagaagatgatccgcgcgcagggcggcgaccccgacgcagcgctcccc
accgcacggcacacccatgaggccaccgccgatcgcgacggctatctcacagagatggac
gccctcgcactgggagtagccagctggcgactcggcgcaggacgcgcacgcaaggaagat
ccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaaggtttcatca
aagggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagccgagcccta
gaatccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgcccctcggtc
atccttgatcgcatcagctaa

DBGET integrated database retrieval system