KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_2019Help
Entry
CpCIP5297_2019    CDS       T02054                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CpCIP5297_2019 (deoA)
Enzymes [BR:coi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CpCIP5297_2019 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2234614..2235954
Genome map
AA seq 446 aa AA seqDB search
MPYSTSPALTAPMEGDTVAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMA
ALNMAIFLNGMDREEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLV
ASYGVAVPQLSGRGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAP
ADKKIYALRDITATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELAR
TMVDLGRDAGTNMVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEM
LELAGVHDPDVHEALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEATADRDGYLTEMD
ALALGVASWRLGAGRARKEDPVQLGAGIEIHAELGEKVSSKGQKLFTLHTDDEDRFSRAL
ESLEPGVNIGDEPPAPRPSVILDRIS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgccatatagcacttccccagccttaacagctccaatggaaggtgataccgtggccgag
aaattcgacgccgtagacgtcatccgcacaaagcgggacaacgggaagctaagcaaggga
caaatcgactggatcatcgacgcctacactcgcggcattgttggcgacgatcaaatggct
gccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtccagtggacc
caggccatgatcgactccggcgagaccatgagctttgccagcctctcccggccaacaaca
gacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcgccactcgtt
gccagttacggcgttgccgtgccacaactctctggtagaggactaggacacacaggcgga
accctagacaaattagaggccatccccgggtgggaagctgacatagataatgcccgaatg
atgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggcctcgcaccc
gccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgcatcccgctg
atcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaacctagtcctcgac
gtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgagctcgcccgc
accatggttgacctaggccgcgacgccggaaccaatatggtcgcgcttctcaccgacatg
tccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtctgtagaagtc
ctcgcaggcggtggcccttccgacgtcatagagctcacctgcgcccttgcgacggagatg
cttgagctcgccggcgtccatgaccccgatgtccacgaagcgcttgccgacggccgcgcg
atggactcttggaagaagatgatccgcgcgcagggcggcgaccccgacgcagcgctcccc
accgcacggcacacccatgaggccaccgccgatcgcgacggctatctcacagagatggac
gccctcgcactgggagtagccagctggcgactcggcgcaggacgcgcacgcaaggaagat
ccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaaggtttcatca
aagggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagccgagcccta
gaatccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgcccctcggtc
atccttgatcgcatcagctaa

DBGET integrated database retrieval system