KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_2115Help
Entry
CpCIP5297_2115    CDS       T02054                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CpCIP5297_2115 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpCIP5297_2115 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpCIP5297_2115 (trpB)
Enzymes [BR:coi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CpCIP5297_2115 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2294741..2295991
Genome map
AA seq 416 aa AA seqDB search
MTLSYNETTQQTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPHFRKELASYLKD
YLGRPTPLTECSKLPLQGKGKGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACTLLNLECVIYMGAKDVERQQPNVYRMELMGATVVSVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMLERTGGLPDVV
VACVGGGSNAIGMFADFIEDASVELVGAEPGGEGLSSGKHGATINNGRIGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSQSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRAALAEEEGKNITILVSLSGRGDKDIDHIRKTLAANPELSLKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcttacaacgaaaccactcagcaaacactccttcctgcatactttggggag
ttcggcggacagtttgtccccgagtcacttcttccagcgcttgatcagcttgaaaaagct
tttgtcgaggcccaagaagacccacactttcgcaaagaactagcgagctatctcaaagac
tatttgggaagaccaactccattaacggaatgctccaagctacctttacagggaaaaggt
aagggatatgcgcgcatcttccttaaacgcgaagaccttgttcacggtggagcacataaa
acaaaccaagttatcggccaggctcttttagctaagaggatgggtaaaaagcgcatcatc
gcagaaactggtgccgggcaacatgggacagcaaccgcccttgcatgcacacttttaaac
ctcgaatgcgtcatttacatgggggctaaagacgtggaacgtcaacagcccaatgtgtat
cgcatggagcttatgggagctactgtagtgtccgtagattcaggttccgggacactcaaa
gatgccgtcaatgaggccctgcgcgattggaccgcaacgttccacgaatcccattatctg
ctcggtacagcagccggacctcatccgtttcccacgatcgtccgagaatttcatcgtgtc
atttcagaggaagctaaagcacaaatgcttgagcgcaccggcggactcccggatgttgtg
gttgcttgcgtgggcggaggctccaacgcaataggtatgtttgcagacttcattgaggat
gcatctgtagaactcgttggtgcggaacccggcggtgagggattatcgtccggaaagcac
ggtgcaaccattaacaatggacgtatcggtatcctgcacggcgccaaaagctatttgatg
cgaaattctgatggtcaagtggaagaatcctattccatttccgccgggctggattatccc
ggagtcggtccacagcacgcgcacctatcgcagtctgggcgagccacctatgtggccatc
acagatgccgaggcgcttgaagccttccaattactttcccgtgaagagggaatcattcca
gcattagagtccagccacgccctcgcatatgcgttgaaaagagctgccctcgcggaggaa
gagggtaagaatatcaccatattggtctccctttcagggcgtggcgataaagacatcgat
cacattcgcaagactctagctgccaaccccgagctttccctcaaggactaa

DBGET integrated database retrieval system