KEGG   Coprococcus sp. ART55/1: CCU_01570Help
Entry
CCU_01570         CDS       T02583                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:coo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCU_01570
Enzymes [BR:coo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CCU_01570
Exosome [BR:coo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCU_01570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(153221..155773)
Genome map
AA seq 850 aa AA seqDB search
MRKRIEEWINWVLYDELIASKINAPKHLLGIHDYGEGQIIVVYKPGAIRVEVTSRTGKKI
HTMEQMTNEGLFAIYFDKKEYDGNKYNVVTTYEDGTIINSADPYSFESLITNFDTYLFAE
GRHYNIYEKLGAHPMTIDGVRGTYFAVWAPHARRVSVVGDFNLWDGNVNPMQITANEGIY
ELFLPGVEPGAVYKYQIMTRYGEILYKADPYGNQCQMRPENASVVADISSYKWKDTSWMK
DRSKISRTDRMRMPMSIYEMHLGSWHKKVEDDDAGFYTYRELAPMVADYLNEMGYTHVEL
MGISEYPFDGSWGYQVTNYYAPTSRYGDAVDFMYFVDYMHSKGISVILDWVPAHFPRDAH
GLGRFDGMPLYEHPDPRRGEHPDWGTYIFDYGRNEVANFLTANALFWVEKFHIDGLRVDA
VASMLYLDYGKQDGQWLPNEHGGNENLEAIALMQNINSIMEERNPGAYLIAEESTAWAGV
TAPASMDGLGFLFKWNMGWMNDFLEYMQMDPYFRQNNQNMLTFSLSYAYAENYVLVISHD
EVVHLKRSMIEKMPGSEEDKFANLRTAYGFMYGHPGKKLLFMGQEFAQPREWSEARSLDW
FVLDNPLNQGMERYVKALNKLYNTNDAMYANDTDPMGFEWTDCDHPDMSILSFVRRGSTP
KKQLLFVCNFTPVERDNYSIPVPCYTTYKEILNSDDVQFGGKGRLNGKPVKAVDKKNART
PYSIDITVPPLSTVVFEYDYTDMTPELEKKEAEAKAAAKKRVDAAKRKAAAAQKKAEEIK
KDAEKKAAELKKEAEKKADELKKEAEKKTAELKKEASEISEEVKDDIADIEKSVVAVADD
IKKDIKARKK
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagaatcgaggagtggataaactgggtgctctatgatgagctcattgccagc
aagatcaatgcgccaaagcatttgctgggaatccatgattatggtgaaggtcagataatc
gttgtgtacaagccgggggcgatcagggtagaggttacatcgcgcacaggcaagaagata
cacaccatggaacagatgacaaatgaaggactgttcgccatttattttgataagaaggag
tacgatggcaacaagtacaatgttgtcaccacatatgaggatggcaccattataaacagt
gcagatccatattcatttgaatcgcttatcacgaattttgacacatacctttttgcggag
ggtagacattacaatatatatgagaagcttggcgcacaccctatgactatagacggtgta
cgtggaacctactttgcagtgtgggctcctcatgcaagacgtgtcagtgtagtcggtgat
ttcaatctctgggatggtaatgtaaatcctatgcagatcacggcaaatgagggaatatac
gaactgttcctgccgggcgtggagccgggcgctgtgtacaagtatcagatcatgaccaga
tatggtgagatactgtacaaagctgatccatatggcaaccagtgtcagatgagaccggaa
aatgcctcagtggttgcagacataagcagctataagtggaaggatacatcatggatgaag
gatagaagcaagatcagccgtactgacagaatgcgcatgcctatgtccatatacgagatg
catctcggctcatggcacaagaaggttgaggatgatgatgcaggcttctacacatacagg
gagctcgctcctatggtggcagactatctcaatgagatgggatatacgcacgtagagctc
atgggtatatcagagtatccatttgacggctcatggggctaccaggttacaaattactac
gcaccgaccagcagatatggcgatgccgtagattttatgtattttgttgattacatgcac
agcaagggaatcagtgttatcctagactgggtgccagcacactttcctagggatgcgcac
ggacttggacgttttgatgggatgcctctctatgagcatccggatccaagaagaggagag
catcctgactggggcacatatatatttgactatggccgcaatgaggtggcaaacttcctc
acggcaaatgctctgttctgggtcgagaagttccatatagacggactccgcgtggatgct
gtggcatccatgttgtatctcgactatggcaagcaggatggacagtggctgccaaatgaa
catggtggaaacgagaaccttgaggcaatagcacttatgcagaatataaacagcatcatg
gaggagagaaatccgggggcatatctaatagcagaggagtcaacagcgtgggcaggtgta
actgctccggcatccatggacggacttggtttcctgttcaagtggaatatgggatggatg
aatgacttccttgagtatatgcagatggatccatatttcagacagaacaaccagaacatg
ctgactttcagtctttcgtatgcgtatgctgagaactatgttctcgtcatatcccatgac
gaggtagttcatctcaagcgttcaatgatagaaaagatgcctggcagcgaggaggacaaa
ttcgcaaatctcagaactgcgtacggattcatgtatggacatccgggcaagaagctgctc
tttatggggcaggaatttgcacagcctagagagtggagtgaggcgagaagccttgactgg
ttcgtcttagacaatccgctcaatcagggcatggagaggtatgtcaaagcgctcaataag
ctttacaataccaatgatgcgatgtatgcgaatgacacagatccaatgggatttgagtgg
acagattgcgatcacccagacatgagcatactttcatttgtaagacgaggctcaactccg
aagaagcagctgcttttcgtatgtaacttcactccggttgagagagataattacagtata
ccggttccgtgctacacgacatacaaggagatactcaactcagatgatgtacagtttggc
ggaaagggcagactcaacggcaagccggtcaaggcagtggacaagaagaatgccagaact
ccttacagtatagacatcacggttccgccactctcaacagttgtgtttgagtacgattac
acggatatgacacctgagcttgagaagaaggaagctgaggccaaggctgctgcaaagaag
cgtgtggacgcagcaaagagaaaggctgcagcggcacagaagaaggctgaggagataaag
aaggatgccgagaagaaagcggctgagctgaagaaagaggcggagaagaaggcagatgag
ctgaaaaaggaagccgagaagaagactgctgagttgaaaaaggaggcatctgagatctca
gaagaggtaaaggatgatatagcagatatagaaaagtcagtggtggctgttgctgatgac
atcaagaaagatataaaagcacgcaaaaaataa

DBGET integrated database retrieval system