KEGG   Coprococcus sp. ART55/1: CCU_08830Help
Entry
CCU_08830         CDS       T02583                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:coo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:coo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:coo00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893681..896170
Genome map
AA seq 829 aa AA seqDB search
MIRYIEEHQVFILETKSTQYAMCVRPDGHLEHLYYGGRSLDCGDQNIVGLWDVAHDRSLF
ETGNAIALDGGLTLESLLQELSSTGKGDVSEPFVCMTHANGSTTCDFVYESYEIKNGRDE
LEGLPCAVEYHRGTDGRFNTVNEQQGTEVGSGVAGGLQSIQAYERQNTAGEVTQLTITLR
DKFYRQKLELIYVTWDDCDVITRSARLTNESDDVERVDRLMSMQFDMRMYQEYDMIHFGG
AWAREMHRSVHPVRQGRVSVSSSTGTSGSRANPFFMVVEHGSSEEHGECYGFNLIYSGDH
MESCEQNSYGRMRILSGINPEGFSFALEPGQSFQSPEAVMTYSDSGFGGVSSHMHAFVRR
HIVRGHWADRERPVLLNSWEAAYFDINEKKLLKLAKEAKKCGIELFVMDDGWFGHRDNDT
SSLGDWQENRSKLPGGVKQLADKINALGLDFGIWVEPEMVNEDSDLYRAHPEWAVRVPGQ
SHAEGRHQMILDLTNKDVRDHIVEAMTNVFSSANISYVKWDMNRIMSDRYSQTLPPDRQS
EFGHRYVLGLYDIMGRLTERFPEILFEGCAAGGNRFDLGILCYMPQIWASDDTDARERLE
IQTGYSYGYPMSVVSSHVSGCPNHQTLRVTPLETRFGVAAFGVLGYECNLCDMRKKDLEA
IEEQVEFYKRHRRTFQFGEYHRIENGTVSDLRRNVYQFMTVSQDGSEAVSCYYEGQVIPN
YTYKHMRTKGLDENAVYVMEGRSLQYSVKLMGDLINTVTPVHVKPDSLTQSAIDKVVKLQ
GEKEYVKASGAVFNRVGVNLAPNFAGTGYNDQTALWTEHGLRLYTFTRQ
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgatcagatatatagaagaacatcaggtattcatactggagacaaagtcgacgcagtat
gccatgtgcgtgcgcccggatggacaccttgagcacctgtactacggtggcaggagtctg
gactgcggagatcagaatattgtgggactttgggatgtggcacatgaccgcagcctgttc
gagaccggcaatgccatagcgctggatggtggacttaccttagaaagtctgctacaggaa
ctgtcgtcaaccggcaagggggatgtcagcgaaccatttgtctgtatgacccatgcaaat
ggcagtacgacctgcgactttgtgtacgaatcatacgagataaaaaacggcagggatgag
cttgaaggacttccgtgtgcggtggaatatcatagggggacagatggcagattcaacaca
gtaaatgagcagcaaggcacagaagtgggaagcggtgtggctggtggattgcagagcata
caagcatatgagcgacagaatacagcgggcgaggtaacacagctcaccataaccctccgg
gacaaattctacagacagaagcttgagctaatatatgtcacatgggatgactgcgacgtg
ataaccagaagtgcccgcctgacaaatgaaagcgatgacgtggagcgggtggacagactt
atgtccatgcagtttgatatgagaatgtatcaggaatatgacatgatacatttcggagga
gcctgggcgagggaaatgcacagatcagtgcaccctgtaaggcagggaagagtgtctgtc
tcatcgtcgaccggaacctcgggcagcagggccaatccgttcttcatggtggttgagcac
ggcagttcagaggaacacggtgagtgttacggcttcaatctcatatattcaggagaccat
atggagagctgtgaacagaattcatatggacgtatgcgtatactcagcggcatcaatccg
gaaggattttcatttgcgcttgagccgggacagtcattccagtcgccggaggcggtcatg
acatattcagattcaggatttggcggtgtcagcagtcatatgcatgcatttgtcagaaga
catatagtcagaggccactgggcggaccgggagaggcctgttctgctgaatagctgggag
gccgcatactttgatataaatgagaagaagctgctgaagcttgcaaaagaggcaaagaag
tgcggcatagagctgttcgtcatggatgacggctggttcggacacagggacaatgacaca
tcctcacttggagactggcaggagaaccgcagcaagcttccgggcggagtgaagcagctt
gcggacaagataaatgcacttggacttgactttggcatatgggtagagccggagatggtg
aacgaggacagtgatctctacagggcacacccagagtgggcggtcagagtgccgggacag
agccatgccgaggggcgtcatcagatgattctggatctcaccaataaggatgtgagagac
catatagtggaagccatgacaaatgtgttctcatctgccaatatatcgtatgttaagtgg
gatatgaacaggattatgtctgaccgctacagtcagacgctgccgcctgacaggcagagt
gaatttggacacagatatgtgcttggactctacgacatcatgggaagactcacggagcgt
ttccctgagatattgtttgagggatgtgccgccgggggaaacagattcgatctcggcata
ctgtgctatatgccgcagatatgggcaagtgatgacacggatgccagggagaggcttgag
atacagacgggatacagctatggttatcctatgtcggtagtcagcagtcacgtgtccgga
tgcccgaatcaccagacactcagagtcaccccgcttgagacgagattcggagtggcggca
tttggcgtgctgggctatgagtgcaatctgtgcgatatgaggaagaaagatctggaggca
atagaagagcaggtggagttctacaagagacacaggcgcacatttcagttcggcgaatat
cacaggatcgagaatggcacagtgtcagatctccggaggaatgtgtaccagttcatgacg
gtttcccaggatggctccgaggcggtgtcctgttattatgaggggcaggtgataccgaat
tacacttacaagcatatgcggactaagggacttgacgagaatgcagtttatgtcatggag
ggcagaagcctgcagtacagcgtaaagctcatgggagatctcatcaacactgttacgccg
gtgcatgtgaaacctgattccctgacccagagtgcgatagacaaggtggtaaagcttcag
ggcgagaaggaatatgtaaaggcgtccggtgcagtgtttaaccgcgttggagtgaacctt
gctccgaactttgcgggaactggctacaacgaccagaccgctctctggacagagcatgga
ctgaggttatataccttcaccagacagtga

DBGET integrated database retrieval system