KEGG   Coprococcus sp. ART55/1: CCU_18810Help
Entry
CCU_18810         CDS       T02583                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
coo  Coprococcus sp. ART55/1
Pathway
coo00220  Arginine biosynthesis
coo00250  Alanine, aspartate and glutamate metabolism
coo00290  Valine, leucine and isoleucine biosynthesis
coo01100  Metabolic pathways
coo01110  Biosynthesis of secondary metabolites
coo01130  Biosynthesis of antibiotics
coo01210  2-Oxocarboxylic acid metabolism
coo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:coo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCU_18810
   00290 Valine, leucine and isoleucine biosynthesis
    CCU_18810
   00220 Arginine biosynthesis
    CCU_18810
Enzymes [BR:coo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CCU_18810
    2.6.1.66  valine---pyruvate transaminase
     CCU_18810
Amino acid related enzymes [BR:coo01007]
 Aminotransferase (transaminase)
  Class I
   CCU_18810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Arc Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBK83366
UniProt: D5HEN3
Position
complement(1961047..1962261)
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSSKLDNVCYDIRGPVMDEANRMVAEGVNVLKLNIGNPAPHGLMAPDEVVRDMAY
NLRDTEGYSDSKGLFSARKAIMQYCQLKNIPNVGIDDIYTGNGVSELITMSMQGLLDSGD
EILVPMPDYPLWTASVNLAGGTAVHYLCDEQSNWYPDIEDIKKKITSRTKGIVVINPNNP
TGALYPKEVLEQIVQVARENELILFADEIYDRLVMDDKEHVALASLAPDLFTISFNGLSK
SHRVAGYRVGWMCLCGNKSNVKGYIEGLNLLSSMRLCSNVPAQSIVQTCLGGYQSADELL
LPGGRIYDQREYIYKALCDIPGISVVKPEAAFYIFPKLDKEKFNITNDEQFALDLLRDKH
ILVTCGTGFNWKDPDHFRIVYLPNMEILKEATAKLADFLSYYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattcgaaaaatcatcaaagcttgacaatgtgtgttacgacataagaggtcct
gttatggacgaggcaaacagaatggtggctgaaggggtaaatgtcctcaagctgaacata
ggaaatcctgcaccgcacggacttatggcgcctgatgaggtggtcagggatatggcatat
aatctcagagatactgagggatattcagattcaaagggacttttttctgcaagaaaggca
atcatgcagtactgccagctgaagaatattccaaatgtaggaatcgatgacatatacaca
ggaaatggagtcagcgagcttattaccatgtccatgcaggggctgctggattctggtgat
gagatacttgtcccaatgccagactatccattgtggacagcatctgtcaacctggcagga
ggaacagcggttcattatctctgcgatgagcagtccaactggtatccggatatagaagat
atcaagaagaagataacctcaagaacaaaaggaatcgtagtcatcaaccctaacaaccct
acaggagctctctatccaaaggaggttcttgagcagatagttcaggttgcaagggagaat
gagcttatcctttttgctgatgagatatatgacagacttgtcatggacgataaggagcat
gtagctcttgcatctctggcaccagatcttttcaccataagctttaacggactgagcaag
tcccaccgagttgcaggttacagagttggctggatgtgtctgtgtggaaacaagagcaat
gtgaagggatacatagagggacttaacctcctgtcatccatgagactttgctcgaatgtt
cctgctcagagtatagttcagacctgtcttggaggctaccagagtgcagatgagctgctc
ttgccgggaggaaggatctatgatcagagggagtatatatacaaagcactctgcgatata
ccgggaataagtgtggttaagccggaggcagcgttctacatattcccgaaacttgacaag
gagaagttcaacatcacaaatgatgaacagttcgctcttgatcttctgagagataagcac
atcctcgtcacatgcggaacgggatttaactggaaggatccggatcacttcaggatagta
tatcttccaaatatggagatactcaaggaggcaaccgcaaagctggctgatttcctgagt
tattatcaccagtaa

DBGET integrated database retrieval system