KEGG   Coprococcus sp. ART55/1: CCU_20280Help
Entry
CCU_20280         CDS       T02583                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCU_20280
Enzymes [BR:coo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CCU_20280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2138824..2140392)
Genome map
AA seq 522 aa AA seqDB search
MLEQNNGKKPKKYAGILAHPTSFPSPYGIGDLGPGAYQFIDFLAASGLNLWQVLPLGHTG
FGDSPYQPFSAFAGQPLIIDIDYLRKKKLLLDEDFSAMPDWDPEKIDYGTLIEFKTGLLK
KAYERFIDADYADDMSGDEDLMAKFDAFVKNTSWLADYSLFMAGKDAHEGMPWYMWDDSL
KKPTARQKTAWKKKLADGIGYYNFLQFLFTEQWQALKTYANDLGISIVGDTPIFLAWDSA
DVWSNQELFLLDSKGYPIEVAGVPPDYFSATGQLWGNPLYNWKKHTETGYAWWIERIKYQ
LTVTDFLRIDHFRGFDRYWAVPYGEETAINGEWKPAPGLNFFTQLEANLGYHLPIIAEDL
GEIDDSVIELRDKFGLPGMKILQFAFENPNENDFLPHNYTPNCVCYTGTHDNDTTLGWYT
QAYEASKDKLRRYYSTDASDICWVMIRACFSSVANMAIVPMQDVLKLDSWARMNTPGVGE
GNWAWRFKASDLGKQLSDRLLETSKLYGRYTPIPEKKDSEEK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcagaacaacggaaaaaagcctaagaagtacgctggtattctggctcacccg
acatcattcccaagtccttatggaatcggagatctgggtccgggcgcttatcagtttatc
gactttcttgcagcttcaggattaaatctgtggcaggtgcttccactcggtcacacgggc
tttggcgattcaccttatcagccattttcagcatttgcaggacaaccacttatcatcgat
atcgactacctcagaaagaagaagttacttctggacgaggacttctcagctatgcctgac
tgggatcctgagaagatcgactatggaacacttatagaattcaagactggccttctgaag
aaagcgtacgagagatttatcgacgctgactatgcagatgatatgtcaggagacgaggat
ctcatggcaaagttcgatgcatttgtcaagaatacatcatggcttgctgactactctctg
ttcatggcaggcaaggatgcgcacgagggaatgccttggtacatgtgggatgattcactg
aagaagccgaccgcaaggcagaagaccgcatggaagaagaagcttgcagacggcatcggc
tactacaacttcctccagttcctttttacagagcagtggcaggccctcaagacatatgca
aatgatctcggaatcagtatagtaggtgacacacctatattcctcgcatgggacagcgca
gacgtatggtccaatcaggaactgtttctgctggattcaaagggataccctatcgaggtt
gcaggtgttccaccagattatttctcagctaccggtcagctctggggcaaccctctgtac
aactggaaaaagcataccgagacaggctatgcatggtggatagagagaatcaaatatcag
ctcacagtaacagatttcctcaggatagatcacttcagaggatttgaccgttactgggca
gtgccttacggtgaggagaccgccatcaacggcgagtggaagccagctccagggctgaac
ttcttcacacagctcgaagctaatctcggctaccatcttcctatcatcgccgaggatctc
ggcgagatagatgattcagtcatagaactcagagacaaattcggacttcctggaatgaag
atccttcagtttgcatttgaaaatccaaacgagaacgacttccttccacataactataca
cctaattgtgtatgctatacaggaacacacgacaacgacaccacccttggatggtatacg
caggcttatgaggcttcaaaggataagctcagaagatactacagcactgatgcaagtgat
atctgctgggttatgataagagcatgcttctcttctgttgccaacatggccatcgttcct
atgcaggacgtgctaaagctcgactcatgggcacgtatgaacacgccaggcgttggagag
ggcaactgggcatggagattcaaagcctcagacctgggcaagcagttgtcagacaggctt
cttgagacatcaaagctctatggaagatatactccaataccggagaagaaggattctgag
gagaagtaa

DBGET integrated database retrieval system