KEGG   Coprococcus sp. ART55/1: CCU_20280Help
Entry
CCU_20280         CDS       T02583                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:coo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2138824..2140392)
Genome map
AA seq 522 aa AA seqDB search
MLEQNNGKKPKKYAGILAHPTSFPSPYGIGDLGPGAYQFIDFLAASGLNLWQVLPLGHTG
FGDSPYQPFSAFAGQPLIIDIDYLRKKKLLLDEDFSAMPDWDPEKIDYGTLIEFKTGLLK
KAYERFIDADYADDMSGDEDLMAKFDAFVKNTSWLADYSLFMAGKDAHEGMPWYMWDDSL
KKPTARQKTAWKKKLADGIGYYNFLQFLFTEQWQALKTYANDLGISIVGDTPIFLAWDSA
DVWSNQELFLLDSKGYPIEVAGVPPDYFSATGQLWGNPLYNWKKHTETGYAWWIERIKYQ
LTVTDFLRIDHFRGFDRYWAVPYGEETAINGEWKPAPGLNFFTQLEANLGYHLPIIAEDL
GEIDDSVIELRDKFGLPGMKILQFAFENPNENDFLPHNYTPNCVCYTGTHDNDTTLGWYT
QAYEASKDKLRRYYSTDASDICWVMIRACFSSVANMAIVPMQDVLKLDSWARMNTPGVGE
GNWAWRFKASDLGKQLSDRLLETSKLYGRYTPIPEKKDSEEK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcagaacaacggaaaaaagcctaagaagtacgctggtattctggctcacccg
acatcattcccaagtccttatggaatcggagatctgggtccgggcgcttatcagtttatc
gactttcttgcagcttcaggattaaatctgtggcaggtgcttccactcggtcacacgggc
tttggcgattcaccttatcagccattttcagcatttgcaggacaaccacttatcatcgat
atcgactacctcagaaagaagaagttacttctggacgaggacttctcagctatgcctgac
tgggatcctgagaagatcgactatggaacacttatagaattcaagactggccttctgaag
aaagcgtacgagagatttatcgacgctgactatgcagatgatatgtcaggagacgaggat
ctcatggcaaagttcgatgcatttgtcaagaatacatcatggcttgctgactactctctg
ttcatggcaggcaaggatgcgcacgagggaatgccttggtacatgtgggatgattcactg
aagaagccgaccgcaaggcagaagaccgcatggaagaagaagcttgcagacggcatcggc
tactacaacttcctccagttcctttttacagagcagtggcaggccctcaagacatatgca
aatgatctcggaatcagtatagtaggtgacacacctatattcctcgcatgggacagcgca
gacgtatggtccaatcaggaactgtttctgctggattcaaagggataccctatcgaggtt
gcaggtgttccaccagattatttctcagctaccggtcagctctggggcaaccctctgtac
aactggaaaaagcataccgagacaggctatgcatggtggatagagagaatcaaatatcag
ctcacagtaacagatttcctcaggatagatcacttcagaggatttgaccgttactgggca
gtgccttacggtgaggagaccgccatcaacggcgagtggaagccagctccagggctgaac
ttcttcacacagctcgaagctaatctcggctaccatcttcctatcatcgccgaggatctc
ggcgagatagatgattcagtcatagaactcagagacaaattcggacttcctggaatgaag
atccttcagtttgcatttgaaaatccaaacgagaacgacttccttccacataactataca
cctaattgtgtatgctatacaggaacacacgacaacgacaccacccttggatggtatacg
caggcttatgaggcttcaaaggataagctcagaagatactacagcactgatgcaagtgat
atctgctgggttatgataagagcatgcttctcttctgttgccaacatggccatcgttcct
atgcaggacgtgctaaagctcgactcatgggcacgtatgaacacgccaggcgttggagag
ggcaactgggcatggagattcaaagcctcagacctgggcaagcagttgtcagacaggctt
cttgagacatcaaagctctatggaagatatactccaataccggagaagaaggattctgag
gagaagtaa

DBGET integrated database retrieval system