KEGG   Coprococcus sp. ART55/1: CCU_20810Help
Entry
CCU_20810         CDS       T02583                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:coo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2194463..2196340
Genome map
AA seq 625 aa AA seqDB search
MDLYEFYSGRCFDAYNELGAHVVKENVGKSRRKAVTGVDFVTYAPNAESVTVTGEFNSWG
ETAMERCYDGSFFKCFVPGAKAGQMYKYKIYQRDGYCVDHCDPYGFGMELRPAFASIIRD
MDEYTFGDARWMRTRNECKGGPLNVYEMHMGSWHCKPVYDENGKQLTPEEVIETDRVAEG
WYTYREIAPMLVEYLKEQGYNYVEFMPLSEHPCDESWGYQNTGFFSPTARYGTADDLKFL
IDTLHKNGIGAIMDYVPVHFALDGYGLAKYDGTNLYEHPTDDVGYSEWGSKNFIHSKGEV
QTFLKSAANYWLTEYHFDGLRMDAISRIIYWMGDESRGVNDRAVEFIKGLNQGLKDRHPS
CILCAEDSTDYKGTTKEVGYGGLGFDYKWDMGWMNDTLNFFRTLPFCRGDQYHKLTFSMM
YFYNERYMLPLSHDEVVHGKATIAQKMAGSYEEKFPNAKALYAYMYAHPGKKLNFMGNEI
AQLREWDEKREQDWDILKYPNHDSFNRFIKDLNKLYLKEPALSGWDDDPHGFDWILCGKE
QDVVYIFQRVIEENKIVVVMNLSGNTYRDYHFRYGEGNSMKVLMNTDWNKYGGNTKDTVK
SIKGVCGDFGFDLPALSVMYLKPVD
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtatgagttttattcgggaaggtgctttgatgcctacaatgagctcggcgca
cacgttgtgaaggagaacgtgggcaagagcaggaggaaagcagtgacaggagtggacttt
gtgacgtatgcaccgaatgcggagtcggtgacggttacaggtgagttcaattcatgggga
gagactgccatggagaggtgttacgatggcagctttttcaagtgttttgtgccgggggca
aaggccggacagatgtataaatataagatataccagagagatggatattgtgtggatcac
tgtgatccgtatggattcggcatggagctgagaccggcatttgcatctataataagagat
atggatgagtatacatttggcgatgcaagatggatgaggacacggaatgagtgcaagggt
ggtccgctcaatgtgtatgagatgcacatgggctcatggcactgcaagccggtgtatgat
gagaatggaaaacagctgacaccggaagaagtcattgagactgaccgagttgctgagggc
tggtatacatacagagagatagcaccgatgcttgtggaatatctgaaagagcagggctac
aattatgtggagtttatgccgctttcggagcatccatgtgatgagtcatggggctaccag
aataccggattcttcagtccgacggctagatacggaacggcggatgacctgaagttcctc
atcgacacgcttcacaagaacggcataggtgccatcatggactatgtgcctgtgcatttt
gcactggatggatatggacttgcaaagtatgacggaaccaatctgtatgagcatccgacc
gatgatgtgggctacagcgagtggggtagtaagaatttcatccattccaagggagaagtt
cagacatttctcaagagtgcggcgaattactggctcacagagtatcattttgatggccta
agaatggatgccatcagcaggataatctactggatgggcgacgagtctagaggtgtaaat
gacagggcggttgagtttataaaggggcttaaccagggacttaaggacagacacccgtca
tgtattctctgcgccgaggattccacggactacaagggaaccaccaaggaagtcggatac
ggcggactgggatttgactacaaatgggatatgggttggatgaatgacacattgaatttc
ttcagaactctgccgttttgcagaggcgaccagtatcacaagctgacattctccatgatg
tatttttataatgagagatacatgctgccactctcgcatgacgaggttgtacatggcaag
gcaaccatagcccagaagatggcgggatcatatgaagagaaattcccaaatgcaaaggcg
ctctacgcctacatgtatgcgcatccgggcaagaagcttaacttcatgggtaacgagata
gcccagctaagagagtgggacgagaagcgtgagcaggactgggatatactgaaatacccg
aaccacgattcatttaacagatttataaaagatttgaataagctctatctgaaagagcct
gcgctgtcagggtgggatgatgatcctcacgggtttgactggatactctgtggcaaagag
caggatgttgtatatatattccagagagttattgaggaaaataagatagtagtagtcatg
aacctatcaggaaatacatacagggattatcacttcagatacggcgagggcaattccatg
aaagtcctcatgaacacggactggaataaatacggtggaaacactaaagacaccgtgaag
agtatcaagggcgtatgcggtgacttcggctttgatcttccggctctgtctgtaatgtat
ttaaagccggtggattag

DBGET integrated database retrieval system