KEGG   Coprococcus sp. ART55/1: CCU_23430Help
Entry
CCU_23430         CDS       T02583                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
coo  Coprococcus sp. ART55/1
Pathway
coo00860  Porphyrin and chlorophyll metabolism
coo01100  Metabolic pathways
coo01110  Biosynthesis of secondary metabolites
coo01120  Microbial metabolism in diverse environments
Module
coo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:coo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCU_23430
Enzymes [BR:coo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CCU_23430
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CCU_23430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: CBK83733
UniProt: D5HFQ0
Position
2478902..2480494
Genome map
AA seq 530 aa AA seqDB search
MVYLIGAGPGDPGLITVKGLEFIKQCDTIIYDRLGTYQLLEMVKPDCRRIYVGKQAGSHY
KKQPEINEILVEEGRKGNMVVRLKGGDPFVFGRGGEEVTALLKAGIPFQVIPGITSAVAV
PEVCGIPVTHRGTSRSFHVITGHKRADIHRSDEGGLDDYDYIRNQEGTSVFLMGLNRLSQ
IMERLVQTGAEENTPVAVISKGTMPGQRIVRGDIQTIADKVNEAKLESPAIIVVGENAAL
DFTAPNRGPLQNVHVGLVGTPKLREKMRVAIDALGGQSYSIVDMSVEQTEEKNRLRMALE
HIEDYSWLAFTSQNTITLFFKWLREWNIDVRKLAHLKLAVVGAGTRDALKVEGYIADYVP
DEYTTSALAMGLANVMNDGEKLLLPRAVQGSETMLDILDQGGVVYEEIPVYDVVGRRMES
IQYLKDLDVITFVSASGVRGFLDVLDAEEKNCGVAHMLNDIDSCGDHTDNTDGSFKIHDI
MKNIRIAALGNVTEKALEKAGYHADIVPEVGDIEHLISAIGDYYFREKRQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggtatatttgataggcgcaggccccggcgatccgggactaatcacggtgaagggcctg
gaattcataaaacaatgcgatacaatcatatatgacagactcggaacctatcagcttctg
gagatggtgaagccggactgccgcaggatatacgtcggcaaacaggcgggcagccactac
aagaagcagcctgagataaatgagatacttgttgaggaaggccgcaaaggcaacatggtg
gtgcgcctcaaaggtggcgatccatttgtgtttggaagaggcggcgaggaagttactgca
cttctaaaagcggggatcccatttcaggtgataccgggaataacatccgcagtggcggtt
ccggaggtgtgcggaataccggtgacccaccgcggaacgagcagaagctttcacgtgata
acaggacacaagcgggcggacatacacagatctgatgaaggtggtttagatgactacgac
tacatcagaaatcaggaagggacaagcgtgttcctgatggggctgaacagactgtcacag
atcatggagagacttgttcagactggggcggaggagaatactccggtcgcggtcatttcc
aagggaaccatgccagggcagaggatagtccgcggcgatatacagacaattgcggacaag
gtgaacgaggcaaagcttgaatctcctgcgatcatagttgtgggtgaaaatgcagcgttg
gattttacagcaccaaacagaggaccgcttcagaatgtccacgttggacttgttggaacg
ccaaagcttcgcgagaagatgagagttgcaatagatgcacttggcggccaatcctacagc
atagtggatatgagcgtggagcagacagaggagaagaacaggctgcgcatggctctggaa
catatagaagattacagctggctggcatttaccagtcagaacaccataaccctgtttttc
aaatggctcagggagtggaatatagatgtcagaaaactggctcatctgaaacttgcagtg
gtcggcgccggaacaagggacgcacttaaggttgagggatatatagcggattacgtgccg
gacgagtacaccacaagcgcccttgctatgggacttgcaaatgtgatgaatgacggagag
aaacttctccttccgagggcagtccagggcagcgagacgatgcttgacatacttgatcag
ggcggtgtggtatatgaggagatcccagtttatgatgtggttggacgcaggatggagagc
atacagtatctgaaggatctggatgtgataacatttgtcagcgcatcaggagtcagagga
tttctagatgttcttgatgcagaggaaaaaaactgcggtgtggctcatatgttgaatgat
atagattcatgtggggatcatacggacaatacagacggcagttttaaaatacatgatata
atgaagaatatccgcatagcggcacttggaaatgtgaccgagaaggctttggagaaggct
ggttatcatgcggatatagttccggaggttggtgatatcgagcaccttatatcagccatc
ggtgattattattttagagaaaagaggcagtaa

DBGET integrated database retrieval system