KEGG   Coprococcus sp. ART55/1: CCU_23620Help
Entry
CCU_23620         CDS       T02583                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:coo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CCU_23620
  Lipid metabolism
   00561 Glycerolipid metabolism
    CCU_23620
   00600 Sphingolipid metabolism
    CCU_23620
Enzymes [BR:coo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CCU_23620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2500049..2502373
Genome map
AA seq 774 aa AA seqDB search
MGIIFHEETKTFHLTNGKISYIMTVLPNGHLGNLYYGKAIRDREDFSHLLELVQRPMFQY
VYDDDRLFSLESVKQELPVYGTTDYRAPMVEVLQSNGSRISDFVYVSHEVNEGKPKLEAL
PATYTENDDEAETLIVTLKDSLTGIKARMLYTIWSDRPVIAKSVEYVNEGTEAVHLTTAY
SMCLDLPDPDYQWMQLSGAWARERNIITRDLEQGVQSIGSNRGHSSHEHNPFIVLKRETT
DENQGEAIGISLVYSGNFKIQAEVDTRNTARILAGINPDTFDWKLDAGEHFQTPEAVIVY
SDQGLNKMSQTFHKLYQKRLARGEWRDKPRPILINNWEATYFDFTREKLIAIAQKAKECG
VELFVLDDGWFGARTTDHAGLGDWVANPDRLPEGITGIAEDIEKVGLKFGLWFEPEMTNK
DSDLYREHPDWILSVPGRHDSHGRFQYVLDFSRKEVVDRIYEMMAKILSTAKVSYVKWDM
NRSITECYSAALPADRQGEVFHRYILGVYDLYERLTSTFPHVLFESCASGGGRFDPGILY
YAPQGWTSDDTDAIERVKIQYGTSMCYPISSMGSHVSVVPNHQTRRETPLKTRANAAYFG
TFGYELDLNKLTAEEIEEVKEQVKFMKAYREVIQYGTFYRLASPFDDEECGWMVVSDDKK
TAIVAWFRTLYTPNKCFTRMKLHGLDPDAIYSCNVLGGQALTVSKTPDGKLIYEKVSGDK
GEDSAVNVIAGPSCYGDELMNLGLITSDTSAGEIVGEDMPCGDYDSRLYVLKAE
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgggtattatttttcacgaagaaacaaagacatttcaccttacaaatggcaagataagc
tacatcatgacagtgctccccaatggacatctgggaaatctgtactatggtaaggcgata
agggacagagaggatttctcacatctgttggagcttgtccagagacctatgttccagtat
gtatatgacgatgacagactgttctcacttgagtcagtgaagcaggagcttcctgtgtac
ggaaccacagactacagagcaccgatggttgaggtacttcagtcaaatggcagcaggata
tcagattttgtatatgtatcacatgaggtaaatgagggcaagccaaagcttgaggcattg
ccggcaacatacacagagaatgatgacgaggcagagacattgatcgtcacattgaaggat
tcactcacaggcataaaggcgagaatgctctatacgatatggagcgacagaccagtcata
gcaaagagtgtggagtatgtaaatgaaggcacagaggcggtacatctcaccactgcttac
agtatgtgtctggatctccctgatcctgattatcagtggatgcagctctcaggcgcatgg
gcaagggagcgcaacataataacaagggatctcgagcagggcgtacagtcgataggcagt
aatcgtggtcattcatcccatgagcacaatccgttcatcgtattgaagagagagacaacg
gacgagaaccagggagaggcgattggaataagccttgtatatagcggcaattttaagata
caggcagaggttgacacgagaaatacagcccgcattcttgccggaataaatccggataca
tttgactggaagctcgatgcaggtgagcatttccagactcctgaggcagtcatcgtatac
tcagatcagggactcaacaagatgagccagactttccacaagctgtatcagaagagactt
gcaagaggcgagtggagagacaagccaaggccgatcctcatcaacaactgggaggctaca
tattttgatttcaccagagagaagctcatagccatcgcacagaaggcaaaggagtgcgga
gttgagctgttcgttcttgacgacggctggtttggagccagaaccacagaccatgcaggc
cttggagattgggttgcaaatccagacagactcccggagggaatcacaggaattgcagag
gatatagagaaggtaggattgaagttcggactgtggttcgagccggagatgacaaataaa
gattcagacctctacagagagcacccagactggatactttcagttccgggaagacatgac
tcacacggaagattccagtacgttctggatttttccaggaaagaggtcgttgacagaata
tatgagatgatggcaaagatactcagcacggcaaaggtgtcatatgtgaagtgggatatg
aacagaagtatcaccgagtgctatagtgcggctcttccggctgacagacagggcgaggtg
tttcacagatacatacttggtgtgtacgatttgtatgagagactcacaagcacatttcca
catgtactctttgagtcatgtgccagcggcggcggacgttttgatccgggcattctctac
tatgcgccacagggctggacaagtgatgacacggatgccatagagagagtcaagatccag
tatggaacatccatgtgttacccgatcagcagtatgggaagccacgtttcggttgtgcca
aatcatcagacaagacgtgagactccgcttaagacccgtgcaaatgctgcatattttgga
acatttggatatgagctggatctgaacaagctcacagccgaggagatagaggaggtcaag
gagcaggtcaagttcatgaaggcataccgtgaggtgatccagtacggaacattctacagg
cttgcaagtccatttgacgatgaggagtgcggctggatggtcgtatcagacgataagaag
accgccatcgttgcgtggttcagaacactctacacaccgaacaaatgcttcaccagaatg
aagctccacggccttgatcctgatgcgatatatagctgcaatgtgctcgggggacaggcg
ctcacagtgagcaagacaccggatggaaagctgatatatgagaaagtgtcaggagacaaa
ggagaggattctgcagtcaatgtcatcgcaggcccatcatgctatggcgatgagctgatg
aacctcggactcatcaccagcgacacatcggcgggagagatagtcggagaggatatgcct
tgcggagactatgattccagactctatgtgctcaaggcagagtaa

DBGET integrated database retrieval system