KEGG   Coprococcus sp. ART55/1: CCU_25500Help
Entry
CCU_25500         CDS       T02583                                 

Definition
Endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:coo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2702092..2703684
Genome map
AA seq 530 aa AA seqDB search
MKNKKTIVMGIIIGILLIIIAVMGYVIASGKKGDSVKKETLQETSAGTEEVKSADNTGDT
TESSEKQDDQSLDIAGDFYAEIGHDTTWEADGKKCATESINIYNNTSAPAKDWKLEITYK
GTPAVDQIWGGEYKISGKTVSIKAVDYTQEIPAKGSINLGYNFSSDDLAVEKYVLYVNDT
QYSGDGLKMAASAPEKTDSNETSGGGKITESAATEKKNNTNVPGEIPFETHGKLSVKGTD
IVDMNGDKYQLKGVSTHGITWFPDYVNKEAFETLRDDWGANLIRLAMYTDTGDSYGYCSG
GDKDEILALVDKGVSAATELGMYVIVDWHILSDSDPNNHIDDAKEFFDKVSKKYAAQENV
IYEICNEPNGGTQWSSVKSYAETIIPVIRANDKDALIIVGTPNWSQDVDIASQDPITGYD
NIMYAVHFYAATHKDDLRNKVKTALDNGLPVFVSEFSLCDASGNGGIDYDSSDEWFKLIN
ENNLSYSSWSLCNKNETSALIKSDSTATGSLSDGDLSDTGKYVRDRIMGK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataagaaaacgatagttatgggaataattattggcattttgctgataattata
gcggttatgggatatgtgatcgcttcgggaaagaaaggtgattccgttaagaaagaaacg
ctgcaggagacttctgcaggcacagaagaagtgaaaagtgctgacaatacgggcgataca
actgagtcgtcagaaaaacaggatgaccaatccttggatattgcaggcgatttctatgct
gagataggacatgataccacgtgggaggcagatggcaaaaagtgtgctacagagagcatc
aacatatataacaacacatctgcgcctgcaaaggattggaagcttgagattacatataag
ggaactccggctgtagatcagatatggggcggagagtacaagatatcaggcaaaacagtg
tcaataaaggccgtggattacacccaggagataccggctaagggcagtatcaacctcgga
tataatttctcttcagatgacctcgccgttgagaaatacgtgctgtatgtaaatgacaca
cagtacagcggagatggacttaagatggcagcttcagcgcctgagaaaaccgacagcaat
gaaacaagcggaggcgggaaaattacagaatccgctgctactgagaagaaaaacaataca
aatgttccgggagagatcccatttgaaacacatggaaaactttcggtaaaaggaacggat
atagtggacatgaatggagacaaatatcagcttaagggtgtcagcacccatggaatcaca
tggttccctgattatgtgaataaggaagcctttgagactctgcgggatgactggggtgca
aatcttataagacttgcgatgtatacggatacaggagacagctacggatactgcagtggc
ggagataaggacgagatacttgctcttgtcgacaaaggagttagtgcagcgactgagctt
ggcatgtatgtcatagttgactggcacatactaagcgatagtgatccgaataatcatata
gatgatgcaaaagaattctttgacaaggtatctaagaaatatgcggcacaggagaatgtc
atatatgagatctgcaacgagccgaatggtggaacccagtggagcagtgtcaagtcgtat
gccgagaccataataccggtcatcagggcaaacgacaaagatgctctgataatcgtggga
actccaaactggagccaggatgtcgatattgcgtcacaggatccgataaccggttatgac
aacatcatgtacgcagtgcatttttatgcggctacccacaaggatgacctgagaaataag
gttaagacggctctggacaacggacttcctgtatttgtgagtgagttcagcctgtgcgat
gcatcgggcaatggaggtattgattacgattcatctgacgagtggttcaagcttataaac
gagaataatctcagctattcatcatggagtctgtgtaacaagaatgagacatcggcactt
ataaagtccgattcaacagccacgggcagcttatccgatggagatctgtctgacaccgga
aaatacgtgagagacagaataatgggaaaatag

DBGET integrated database retrieval system