KEGG   Coprococcus sp. ART55/1: CCU_26160Help
Entry
CCU_26160         CDS       T02583                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
coo  Coprococcus sp. ART55/1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:coo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCU_26160
  Amino acid metabolism
   00340 Histidine metabolism
    CCU_26160
Enzymes [BR:coo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CCU_26160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2773280..2774101
Genome map
AA seq 273 aa AA seqDB search
MTTPCNAEGEVYATTLVAAKEAGVDEIYKAGGAQAIAALAYGTESVPKVDKIVGPGNIFV
ALAKRAVYGHVSIDSIAGPSEVMVLADETANSRYVAADLLSQAEHDEMASAILVTTSEEL
AEKVSVQVDKFIDELSRKEIMRKSIDNYGYILLADNMSDAIDAVNDIASEHLEIVTANPF
DVMTRVKNAGAIFIGEYSSEPLGDYFAGPNHVLPTNGTAKFFSPLSVDDFIKKSSIIYYS
REALEAVHTDIEAFAKAEQLTAHANSIAVRFEK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacaactccatgtaatgctgagggtgaggtgtacgccacaacactcgttgcagcaaag
gaagcaggagtggatgagatatacaaggcaggcggcgcgcaggccatagctgcccttgca
tacggaacagagtcagtacctaaggttgacaagatagttggccctggaaacatatttgtc
gctcttgcaaagcgtgccgtatacggacatgtcagcatagattccatagccggcccatca
gaggtaatggtacttgccgatgagactgccaattctagatacgtggctgcagatctgctg
tcacaggcagagcatgacgagatggcatcagccatacttgtgaccacatcagaggagctt
gccgagaaggtatcagttcaggttgacaagttcatcgatgagctttcaagaaaagagata
atgagaaagtctatagacaattatggatatattcttcttgcagacaacatgagcgatgcc
atagatgctgtcaacgacattgcatcagagcatctcgagatcgtcacagccaatccattt
gacgtgatgacaagagtgaagaatgctggagctatatttatcggagaatactcatcagag
cctcttggagattactttgcaggccctaaccatgtacttccaacaaacggtacagcaaag
ttcttctcaccgctttcagtagacgatttcatcaagaaatccagcataatctactattca
agagaggcacttgaggcagttcacactgacattgaagcatttgccaaggctgagcagctc
acagcacatgccaattcaatagcagtaagatttgaaaaataa

DBGET integrated database retrieval system