KEGG   Corynebacterium pseudotuberculosis 31: Cp31_0107Help
Entry
Cp31_0107         CDS       T02029                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cp31_0107 (glpK)
Enzymes [BR:cop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cp31_0107 (glpK)
Exosome [BR:cop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cp31_0107 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(93219..94706)
Genome map
AA seq 495 aa AA seqDB search
MQYVAAIDQGTTSTRCIIFDHDGNQVSVGQYEHEQIFPQKGWVEHDAIEIWDNTRRAVGT
ALADSDLSAKDIAALGITNQRETTVVWDKNTGEPVYNAIVWQDTRTTSICKELAGDEGAD
RWYRKTGLLINSYPAGPKIKWILDNVDGARERAEAGELLFGTIDTWLLWNLTGGADGDDG
APALHATDVTNASRTLLMDIEKLEWDKELCKAMDIPMEMLPEIRPSVGDFHQVRERGSLS
GVPIRSMLGDQQAAMFGQGCFRPGEAKNTYGTGLFLLLNTGTTPKWSENGLLTTVCFQIE
GQKPVYALEGSVAVGGSLVQWLRDNLMLVPNAPMIENMARSVEDNGGVYIVPAFSGLFAP
YWRQDARGVIVGLTRFVNRNHLARAVLEATAYQTRDVADAMVADSDVKLTELRVDGGMTY
NELLMQFQADILGVPVTRPKNVETTATGAAFAAGYSVGYWENLDFLTQQKAIYTSGSLQW
IRKKSTSFTAIGSAQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtagcagccatcgaccaaggcactacttcaacccgctgcatcatctttgac
catgacggcaaccaggtctccgttggtcaatatgaacacgaacaaatcttccctcaaaaa
ggctgggtagagcatgacgccatcgaaatctgggacaatacccgccgcgcagtagggacc
gcccttgcagacagcgacctgtcagctaaagacatagcggccctaggcatcactaaccag
cgcgaaaccacagtggtctgggacaaaaacaccggcgagcccgtgtacaacgccatcgtg
tggcaagacactcgcaccacctcaatctgcaaagaactcgctggtgatgaaggcgctgac
cggtggtaccgcaagaccggcctcctcatcaattcttatcccgctggtcccaaaatcaag
tggattctagacaacgttgacggcgcccgcgagcgagccgaggcaggagaactcctcttt
ggcaccatcgacacatggctcctttggaacctcaccggcggcgccgatggcgatgacggc
gcaccggcattgcacgcaaccgacgtgactaatgcttcccgcaccctcctcatggatatt
gaaaaactggagtgggacaaagaactctgcaaagccatggatatccccatggaaatgctc
cctgagatacgtccatcagtcggcgatttccatcaagtacgtgaacgtggatcgctctcc
ggggtccccattcgatcaatgcttggcgaccaacaagccgccatgtttggccaaggttgt
ttccgtccaggtgaggcaaaaaacacctacggaacaggcctcttcctgctcctcaacaca
ggaaccacccctaagtggtccgaaaacggcttgctcaccacagtttgcttccaaattgaa
ggccaaaaaccggtctacgcattggaaggttcagttgctgtaggaggatcgctagtccag
tggctgcgcgataacctcatgcttgtccccaacgctcctatgatcgagaacatggcacgc
agcgttgaagacaacgggggcgtctatatcgttccagctttctccggacttttcgcgcca
tactggcgacaagacgcccgaggcgtcatcgtcggactcactcgctttgttaaccgcaat
cacctagctcgcgccgttttggaagcaaccgcataccaaacccgcgacgttgcagacgcc
atggtcgccgactcagatgtgaagctcactgaacttcgtgtcgacggcggaatgacctac
aacgaactcctgatgcagttccaggcagatatccttggcgtcccggttactcgccctaaa
aacgtggagaccacggccaccggagccgcctttgccgccggttattctgtcggctactgg
gaaaatcttgatttcctcactcagcaaaaggcgatttacacgtctggaagcctacaatgg
atcaggaaaaagtcgacgagctttaccgcgattggaagcgcgcagtaa

DBGET integrated database retrieval system