KEGG   Corynebacterium pseudotuberculosis 31: Cp31_0281Help
Entry
Cp31_0281         CDS       T02029                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cop00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285666..287354
Genome map
AA seq 562 aa AA seqDB search
MSSTPQPTPVTPAPEGKVIFVGAGPGNPDLLTVRAREVLSHTAFAVVDAEVLPGVRSVVA
RELDVPMDKVQAAEEEYERLCAEAKEAGARRKPQRPDAPTAAEITEVDDDVPVVEVVEKL
KELLSSGEDVIRLVQGNPLSCDRTLEEISAVKQAGLEFHVVPGMSLPATVPAFAGIALGS
SYTETDVTGEDVDWEQLAAAPQPLVLQATKEDLPTIAAELKSRGIEASTPVTVTARGTTR
LQRSFDISLGALHKLDGDLAGTLVVTLGKAADERTKYSWWENRSLFGWRVLVPRAKEQAG
SMSALLAAQGAIPQEVPTISVEPPRNPAQMEKAVKGIVEGRYQWVIFTSVNAVKSVREKI
GSFGLDARAFAGVRIGAVGTKTAKAIRELGITPELLPPRNRQNAAGLVSVFPEYVEDLDP
VGRVLLPRADIATDVLVEGLEGLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGGFDAVCFT
SASTVKNLVGIAGKPHQRTIIACIGPMAAAAAKELGLRVDVIPEVADVPHLINGLATHVA
QLRAAGQLPPPRKKRRARKNRE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgactccgcaacccaccccggtaacccctgcaccggagggaaaagtgatcttt
gtaggagcaggaccaggaaaccctgatctgctcaccgttcgcgcccgcgaagttctcagc
cataccgcttttgccgtagtagatgcagaagttctaccgggggttcgctcagtggttgca
cgtgaactcgatgtgccgatggataaagttcaggcggctgaggaagaatacgagcggctg
tgcgcggaagcaaaagaagctggtgcgcgccgtaaaccgcagcgcccggacgccccgact
gccgctgagattacagaagtagacgacgacgttcctgtagtagaggtagtggaaaagctt
aaggagcttttgtccagcggggaagacgttattcgcctggtgcagggaaaccccttgtca
tgtgaccgaaccctggaagaaatttctgcggtcaaacaggccgggctggagttccacgtg
gttcccggcatgtccttgccggcgaccgttcctgctttcgcgggtatcgctctgggctct
tcttatacagaaaccgatgtaactggggaagacgtagattgggaacagcttgctgcagca
cctcagccgctggttttgcaggcaactaaagaggatctgcccacaatagccgcagagtta
aaatctcgtgggatagaggcatcgaccccggtgacggtgacagctcgcgggacaacacgc
ttgcaaagaagttttgatattagtttgggcgccctgcacaagttagacggggacctcgcc
ggaaccctcgtggttactttaggcaaagcagcggatgaacgtaccaagtattcttggtgg
gagaaccgttcgctctttggttggagagtgctggtcccccgtgcaaaagaacaagccgga
tcaatgagtgcattgttggctgctcagggggcaatcccgcaagaagttcccacaatctct
gtggagccgccacgcaatcctgcgcaaatggagaaggccgttaaagggatcgtggaaggc
cgctaccaatgggtgatttttaccagcgtcaacgcggtgaaatccgtgagagagaaaatc
ggttccttcggactcgatgctcgtgcctttgccggtgtacgcattggagcggtaggaaca
aaaactgctaaggctatccgtgagcttggaatcacgccggagttgctccctccgagaaat
cggcaaaacgctgcaggtttagtgtcagtgttcccggagtatgtggaagaccttgatcca
gtcggacgggtcctcttgccccgggcggatattgcaacggacgtcctggtggaaggctta
gaaggccttggctgggaggtcgacgatgtggtggcgtatcgcacggtacgggccgccccg
ccgagtgcagaagtgcgcgacatgattaaaagtggcggttttgacgctgtgtgctttacc
tctgcatccacggtaaaaaatctggtgggcattgctgggaaaccacatcagcgcacaatc
attgcatgcattggtccgatggcggcggcagcggcaaaagaattaggtctgcgggtggac
gtgatccccgaggtagcggatgttcctcacttgattaatggtcttgctacccacgtggca
caactgcgcgcagctggccagctgccgcctcctaggaagaagcggcgcgcccgaaaaaat
cgcgagtaa

DBGET integrated database retrieval system