KEGG   Corynebacterium pseudotuberculosis 31: Cp31_0617Help
Entry
Cp31_0617         CDS       T02029                                 

Gene name
echA6
Definition
(RefSeq) Enoyl-CoA hydratase echA6
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cp31_0617 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cp31_0617 (echA6)
   00650 Butanoate metabolism
    Cp31_0617 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp31_0617 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cp31_0617 (echA6)
   00310 Lysine degradation
    Cp31_0617 (echA6)
   00360 Phenylalanine metabolism
    Cp31_0617 (echA6)
   00380 Tryptophan metabolism
    Cp31_0617 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cp31_0617 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cp31_0617 (echA6)
   00281 Geraniol degradation
    Cp31_0617 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cp31_0617 (echA6)
   00627 Aminobenzoate degradation
    Cp31_0617 (echA6)
   00930 Caprolactam degradation
    Cp31_0617 (echA6)
Enzymes [BR:cop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cp31_0617 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
640175..641011
Genome map
AA seq 278 aa AA seqDB search
MLEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALASGFAAIQGDHAAAVAFAHEVAGLAPLSVRQLKSALNYGEAN
YSLDERSQSLFSQCWSSQDMREARQARLEKRVPQFKGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgacatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggcgctgggatgcagcttgct
ttggcgtgtgatctccgcgttgttggggagtctgcatggtttaaagtccccgctgtttct
ttgggctttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcgttgaccccggatgcggctctggctagt
ggttttgccgcaattcagggggaccatgccgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggcagctcaagtcggcgcttaattatggggaggctaat
tactcgttggatgagcgctcacaatccttattttcccagtgctggtctagtcaggatatg
agggaagcgcgacaggcgagactggagaaacgagttccccaatttaaggggcgataa

DBGET integrated database retrieval system