KEGG   Corynebacterium pseudotuberculosis 31: Cp31_0640Help
Entry
Cp31_0640         CDS       T02029                                 

Gene name
cysQ
Definition
3'-phosphoadenosine 5'-phosphate phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cp31_0640 (cysQ)
Enzymes [BR:cop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Cp31_0640 (cysQ)
Transfer RNA biogenesis [BR:cop03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Cp31_0640 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(662315..663199)
Genome map
AA seq 294 aa AA seqDB search
MMWLFPNGFSCHCKQNTMKNSQNRYADGLVVRNARAPLNFRVMTAHFDDATLTKRLAQGT
GEILKGVRNVGLLRGRELGDAGDDLAQNWIARVLEQHRPDDGFLSEEAADNPERLGKDRV
WIIDPLDGTKEFATGRQDWAVHIALVEDGTPTHAAVNLPDLGVVFHTSEVRAVRGPYAKK
IAVSHNRPPAVANHVAEKLGFTAEPLGSAGAKAMHVLLGDYDAYIHAGGQYEWDSAAPVG
VSLAAGLHCSRLDGSPLTYNNKDTYLPDLLVCRPELADDILSMVAAFREENGSY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtggttgtttcccaatggattttcttgtcactgtaaacaaaacacaatgaaaaac
tcacaaaatcgatacgctgacggtctagtagtgcgaaacgcccgtgctccattaaacttt
agagtcatgactgctcactttgacgacgcgaccctaaccaagcgacttgcccagggaacg
ggcgaaattctcaaaggggtaagaaacgtaggtcttttacgcgggcgtgaactaggcgac
gccggagatgatctggcacagaactggattgcacgtgtgctggaacaacaccgacccgat
gatggattcctttctgaagaagccgcagataacccagaacgcctaggaaaagatcgtgtc
tggattattgatccgcttgacggcaccaaagagtttgccacagggcgccaagactgggct
gtacacatcgctttggtggaagacggaacaccgacccacgccgcagttaaccttcccgac
ttgggggttgtgttccatacctctgaagttcgtgcagtacgcggcccttatgccaagaag
atcgcggtctctcacaaccgtcctcccgctgtagccaaccacgtcgctgaaaaactaggt
tttactgctgagcctctcggttctgccggggcgaaagccatgcacgtgcttctcggcgac
tatgacgcctacatccatgctggcggccaatatgagtgggactccgcagctcccgttggt
gtcagcctagcggctggactgcactgctcgcgtctcgatggctccccgctgacttataac
aacaaagacacctatcttccggatcttcttgtctgccgtcccgagcttgccgacgatatc
ctttccatggtggccgccttccgcgaggaaaacggctcgtactaa

DBGET integrated database retrieval system