KEGG   Corynebacterium pseudotuberculosis 31: Cp31_0671Help
Entry
Cp31_0671         CDS       T02029                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
cop00040  Pentose and glucuronate interconversions
cop00052  Galactose metabolism
cop00500  Starch and sucrose metabolism
cop00520  Amino sugar and nucleotide sugar metabolism
cop01100  Metabolic pathways
cop01130  Biosynthesis of antibiotics
Module
cop_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cp31_0671 (galU)
   00052 Galactose metabolism
    Cp31_0671 (galU)
   00500 Starch and sucrose metabolism
    Cp31_0671 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp31_0671 (galU)
Enzymes [BR:cop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cp31_0671 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFH90494
Position
763809..764765
Genome map
AA seq 318 aa AA seqDB search
MDTGCTLICMKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIEL
IAEEAAQLGATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPV
SVVQEKPLGLGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCA
FEVPEEEVYNYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFD
ALRRITPGAGGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPA
YGPHLKKVLRKILEEHGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggataccggatgtactcttatctgcatgaagcagcctcaagaagctcaagacagtacg
cgcgtcgcggtgaagactgtcatcgttcctgctgctggcatgggaacgagattccttcct
gccacaaaaacggttcctaaagaactattgccagtggtagataccccaggcattgaactg
attgcagaagaagcagctcagttgggggcaactcgactcgcagtaattacggctcctaat
aagcaggaagtcatggagcactttaagcgattcccagtgttggaagagaccctacaaagc
cggggcaaaaccgaacaatatgaaaaagttgttcatgcctctgagcttattgcgccagtt
tccgtagtgcaggaaaagccgctcggccttgggcatgctgttggcatggcggaatcagtc
cttgatcctgatgaggacgctgtagcagtcatgcttcccgatgatctagtgcttccgcgg
ggcgtcgtggagaagatggtcgaggtacgcgagcaactaggcggatctgtgttgtgcgcc
tttgaagtgccggaggaagaagtctataactacggtgtctttgagatcgatgagagtgca
tatgatggccctcatcacgtcaaaaaagtcaaaggaatggtagaaaaaccctctgtagaa
gaggctccttcaaattttgtggctaccggccgctatttgctcgaccgggctatttttgat
gcactccgtagaattaccccgggtgctggcggtgagctgcaactcacggatgccattgat
ttgcttatcgacgaaggccaccctgtgcatattcttgtgcatgacgggaagcgtcatgat
cttggcaaccccgggggatacataccggctgttgttgattttgggttgcgcgatccagcg
tatgggccgcacttaaagaaggtcctccgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system