KEGG   Corynebacterium pseudotuberculosis 31: Cp31_0888Help
Entry
Cp31_0888         CDS       T02029                                 

Gene name
pfkA
Definition
6-phosphofructo kinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp31_0888 (pfkA)
   01230 Biosynthesis of amino acids
    Cp31_0888 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp31_0888 (pfkA)
   00030 Pentose phosphate pathway
    Cp31_0888 (pfkA)
   00051 Fructose and mannose metabolism
    Cp31_0888 (pfkA)
   00052 Galactose metabolism
    Cp31_0888 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Cp31_0888 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cp31_0888 (pfkA)
Enzymes [BR:cop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cp31_0888 (pfkA)
Protein phosphatases and associated proteins [BR:cop01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cp31_0888 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927642..928670
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAEIDALIPIGGEGTLKGAQWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEHPFDINEICKAMERRFQMGEKYGIIVVAEGALPKEGTMSFAQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVPAARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctctggtggcgattgccccggactcaacgctgtcatccgc
ggtatcgtccgcacctgttccgaatacggttctaccgttgtgggatatgaggacggttgg
gttggtcttatggaagacaagcgcattcaactttacgatgatgaaaatattgatcgtatt
cttttgcgcggcggaacgatcttgggaactggccgccttcaccccgataagttcaaggca
ggacttgagcaaatcaaagagaatttagcagacgccgaaattgatgctttgattccgatt
ggtggcgagggcacgctaaagggagcccaatggctttctgataatgggatccctgtggtg
ggcgttcccaaaactatcgataatgatgtcaatggtaccgattacacctttggctttgac
accgcagtgtcggtagcaactgacgcaattgatcgtttacataccaccgcagaatcccac
aatcgcgtgatgatcgtggaagtgatggggcgtcatgtcgggtggatcgcattgcatgcg
gggatggcaggcggagcacactacactgtgattccagagcatccttttgatatcaatgag
atctgcaaagcgatggaacgccgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggggctttgcctaaggaaggaacgatgagttttgcccaggggtgcgtagaccaa
tttgggcatcaaacctttaatggcatcggccaggtgatcggcgaagaaataaagaggcgc
ctaggtcatgacgtacgtactactgtgctcggacacatccaacgcggcggtactccgact
gcttatgatcgtgttttggcaacccggtatggtgttcacgctgcccgtgcttgccataca
caagactttggcaagatggtggcacttcatggtgagcatattgacctaattcctttggaa
gaagcagtaggaactttgaaggtagttcctgcggctagatatcggacagccagagctctc
tttggataa

DBGET integrated database retrieval system