KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1185Help
Entry
Cp31_1185         CDS       T02029                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cop00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cp31_1185 (ruvA)
Enzymes [BR:cop01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cp31_1185 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1274472..1275083)
Genome map
AA seq 203 aa AA seqDB search
MIVSLRGTVASIGLGSAVIECNGVGYEVLASPSTLSQMRRGEEFFVLTTMVVREDSQTLY
GFASDEARQMFTLLQTVSGLGPKLALAAQSVLSAVDLAQAIANQDAKTLQRIPGVGKRVA
ERIIVDLKDKVSAFITDGGATPASGGSSSATSDVSAPVLEALLGLGFTEKVAEPALNSVL
SESPNATTSQALRLALSTLGKKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcccttcgcgggactgtagcctccatcggtcttggtagcgcagttattgaa
tgtaacggggttgggtatgaggtgctcgctagtcccagcactttgtctcaaatgcgcaga
ggcgaagaattctttgtcctgactacgatggtggtcagagaagactcccaaactctttat
gggtttgctagtgatgaagctcggcagatgtttacgctgctgcagactgtctctggacta
gggccaaagctggcgttggcggcacaatcagtgttgtcagcagtggatttagctcaggcg
attgctaatcaggatgcaaaaactctacaacgtatccccggggtgggaaagcgagttgca
gagcggattattgtcgacctcaaagacaaggtttcagcttttattaccgatgggggtgct
acccctgcgtcgggaggctcatcttctgcaacgagtgatgtttccgcaccggtgttggag
gctcttctcggacttggatttacagagaaagttgcagaacctgcgttgaattccgtgttg
agcgaatctccgaacgctactacatcccaggcgctgcggttagccctgagcacgctgggg
aaaaagaaatag

DBGET integrated database retrieval system