KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1368Help
Entry
Cp31_1368         CDS       T02029                                 

Gene name
trpC2
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cop01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cop00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1470881..1471783)
Genome map
AA seq 300 aa AA seqDB search
MVHGPKKQAIFTSAGCSSSLKTIILKIMGRVMPSVFEEIIAGVIEDVAARESVVSFKEIK
ARSRACEPPRDAIAALLNSGCGVIAEIKRAAPDKGVLAEINSPVGLAKELVAGGASLIAC
QTERRRFHGSLSEMAEIRNVISVPIMCRDFIVDPYQIHEARCYGADMVPLRVAALDQARM
IALIDRIESLGMAALVEVRDTEEASRAVAAGAKIIGVNARDFSTMTLNRLAFAEIAPGLP
TDVIRVALSGVRNARELLDYAASGADAVVVGEKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggttcatggccccaagaaacaggcaattttcacaagtgcaggttgttccagtagccta
aaaacgatcattctaaagataatgggacgggttatgccatcagtcttcgaagagattatt
gcgggcgtcattgaagatgtagctgcgcgagaatcagtggtgtcgtttaaagagatcaaa
gcccgttcgcgtgcttgcgagccgcctcgggatgcaatagcggcgcttcttaatagtggt
tgtggtgtgatcgctgagattaaacgtgctgctccagataaaggcgttttagcagagatc
aattctcctgttggcttagcaaaagaacttgtcgccgggggcgctagtttgattgcgtgt
cagacggaacggcgaaggttccacggttcattatctgagatggctgagattcgtaatgtg
atatcggtgccaataatgtgccgagactttatcgtggatccctatcaaattcatgaggca
cgctgttatggagcggacatggtgcccttgcgcgtagctgctttagaccaagccaggatg
attgcgcttatagatagaatcgagtccctgggaatggcagcgctggtagaagtccgggat
actgaggaagcatcgcgtgcggtggcagcgggtgcgaagatcataggggtaaacgcccgg
gatttctcaacgatgacgctcaaccgcctggccttcgcagaaattgctcctggacttcct
acagatgttattagagttgcattgtccggtgtgcgcaatgctcgtgaactcctggattac
gctgcctctggtgcggacgcggtggttgtgggagaaaaaattgttactgctgcggatccg
tgcgaagcgacgcgttcgttggtggcagcaggccaacatccatcgtgtccatcgcgagga
taa

DBGET integrated database retrieval system