KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1447Help
Entry
Cp31_1447         CDS       T02029                                 

Gene name
asnB
Definition
Asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cop00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1554280..1556202
Genome map
AA seq 640 aa AA seqDB search
MCGLLGMLTSTRDAQRYVSAIEKSLPCMRHRGPDEAGTWHDQQAVFGFNRLSIIDLEHSH
QPLKWGPQGQTDRYAMTFNGEIYNYVELRAELQELGYTFNTSGDGETIVVGYHHWGAEVV
QHLRGMFGFAIWDSQEEKLFLARDQFGIKPLYYATTDAGTIFSSEKKCILEAAEDIGLDL
SLDQRAIEHYVDLQYVPEPESLHANIRRLESGCYGEIVPGGKVKQTRYFRPQFPAQEVPT
SKEQDLFDRIARALEDSVEKHMRADVTVGSFLSGGIDSTAIATLAKRHNPNLLTFTTGFE
REGYSEVDVAAESAAAIGVEHIVKVVSPEEYANAIPQIMWYLDDPVADPSLVPLFFVAQE
ARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRRGLGQLAKVFPEGMRGKSL
LERGSMTVEERYYGNARSFNFEQMQRVLPWAKKEWDHREVTAPIYAQSTHMDPVARMQHL
DLFTWMRGDILVKADKINMAHSLELRVPFLDKEVFAVAETIPHSLKVTQGTTKYALRKAM
EQIVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTITESLTDHIFDKKAVLDMLNEHRA
GVSDHSRRLWTVLAFMVWHGIFIENRIDPGIEKKDYPVYL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggacttcttggcatgcttacgagcacaagggacgcccaaaggtatgtctcggcc
atcgaaaaatcgctaccgtgtatgcgtcacaggggcccagatgaggctggaacgtggcat
gaccagcaagccgtctttgggttcaatcgcctttctatcatcgatctagaacattcccat
cagccactaaaatgggggccgcaaggccaaactgatcgctacgcaatgacgtttaatggc
gaaatctataactatgtagagctcagggcagaactacaggaactcggttacacctttaat
acctcaggcgatggcgagaccatcgttgttggatatcaccactggggcgccgaggttgtc
caacacctgcggggcatgtttggctttgctatttgggattctcaggaggaaaaactcttc
ctcgcccgcgatcagtttggtatcaagccgctgtattacgcaaccacagacgccggcacc
attttttcctcggagaagaaatgcattttggaagctgccgaggacattggtctagacctc
agccttgatcaacgagctattgagcattacgttgatctgcaatacgtaccagaaccggaa
agtcttcacgcaaatattcgccggttagaatcaggctgttacggggaaattgtccccggc
ggcaaggtcaaacagactcgttatttccgtccccaatttccagcgcaggaagttcccacg
agcaaggaacaggatctttttgatcgaatcgcccgcgcgttagaggatagcgtcgaaaag
catatgcgtgccgacgtcaccgtgggatccttcctctccggtggcatcgattccactgcg
atagctacgttggccaagcgccacaaccctaatttgttgaccttcaccacaggttttgag
agagaaggttactcagaggttgatgttgccgcggagtctgctgcagcgatcggcgtagag
cacatcgttaaggttgtgtcaccagaggagtacgccaacgccatcccccagattatgtgg
tacctggatgaccccgtagcagatccctcacttgtccccctcttctttgtggcccaagaa
gctaggaagcatgtcaaggttgttctctccggcgaaggcgcggacgaacttttcggcggt
tacaccatttataaagagccgttgtctctcgccccctttgaaaaaatcccgtccccccta
cgtcgaggcctagggcagctcgccaaggttttccccgaaggcatgcgcggcaagtccttg
ttagagcgcggttccatgaccgtggaagaacgctattacggcaatgctcgctcatttaac
tttgagcagatgcagcgcgttttgccatgggctaagaaggaatgggaccaccgcgaggtc
acagccccaatctacgcccagtccacgcatatggatccggtggcgcgcatgcagcacctt
gatctttttacgtggatgcgaggcgatattttggttaaagccgataagatcaacatggca
cattcccttgagctccgagttcccttcttggataaagaagtgtttgcggtcgccgagact
atcccccatagtctgaaggtcacacagggaaccaccaagtatgcgctgcgtaaggcaatg
gaacagatcgttccaccgcatgtcctgcaccgtaagaaactcggtttccctgtccccatg
cgccattggctagctggagacgagctattcggctgggctcaagacaccattacggagtca
ctcacagaccatatctttgacaagaaagctgtcttggacatgctcaatgaacacagagca
ggagtcagtgaccattctcgtaggctatggactgttcttgcctttatggtgtggcatggg
atctttatagaaaaccgaatcgatcctggaatcgagaaaaaggactatccggtttatctc
tag

DBGET integrated database retrieval system